@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv3913: (2016-05-24 )
MTAPPVHDRAHHPVRDVIVIGSGPAGYTAALYAARAQLAPLVFEGTSFGGALMTTTDVENYPGFRNGITGPELMDEMREQALRFGADLRMEDVESVSLHGPLKSVVTADGQTHRARAVILAMGAAARYLQVPGEQELLGRGVSSCATCDGFFFRDQDIAVIGGGDSAMEEATFLTRFARSVTLVHRRDEFRASKIMLDRARNNDKIRFLTNHTVVAVDGDTTVTGLRVRDTNTGAETTLPVTGVFVAIGHEPRSGLVREAIDVDPDGYVLVQGRTTSTSLPGVFAAGDLVDRTYRQAVTAAGSGCAAAIDAERWLAEHAATGEADSTDALIGAQR

Atome Classification :

(49 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FDA_A_2(4JNQ)
?
[Raw transfer]




FAD_E_5(1VDC)
TRXB1_ARATH
[Raw transfer]




FDA_A_2(4JNQ)
?
[Raw transfer]




FAD_B_5(4UP3)
?
[Raw transfer]




FAD_B_6(2WHD)
?
[Raw transfer]




FAD_A_3(2Q7V)
?
[Raw transfer]




FAD_A_5(3ITJ)
TRXB1_YEAST
[Raw transfer]




FAD_A_3(4UP3)
?
[Raw transfer]




FAD_B_7(3ITJ)
TRXB1_YEAST
[Raw transfer]




FAD_C_10(4CCR)
?
[Raw transfer]




FAD_A_6(4CCQ)
?
[Raw transfer]




FAD_D_13(3ITJ)
TRXB1_YEAST
[Raw transfer]




FAD_A_3(2WHD)
?
[Raw transfer]




FAD_B_4(2Q7V)
?
[Raw transfer]




FAD_C_3(1CL0)
TRXB_ECOLI
[Raw transfer]




FAD_D_12(4CCR)
?
[Raw transfer]




FAD_A_2(1TDE)
TRXB_ECOLI
[Raw transfer]




FAD_A_5(3ITJ)
TRXB1_YEAST
[Raw transfer]




FAD_B_7(4A5L)
?
[Raw transfer]




FAD_A_5(2A87)
TRXB_MYCTU
[Raw transfer]




FAD_B_10(4CCQ)
?
[Raw transfer]




FAD_E_5(1VDC)
TRXB1_ARATH
[Raw transfer]




FAD_A_3(2Q7V)
?
[Raw transfer]




FAD_A_8(4CBQ)
?
[Raw transfer]




FAD_B_5(3D8X)
TRXB1_YEAST
[Raw transfer]




FAD_C_10(3ITJ)
TRXB1_YEAST
[Raw transfer]




FAD_B_15(4CBQ)
?
[Raw transfer]




FAD_B_10(4A65)
?
[Raw transfer]




FAD_C_3(1TRB)
TRXB_ECOLI
[Raw transfer]




FAD_A_6(4CCR)
?
[Raw transfer]




FAD_B_8(4CCR)
?
[Raw transfer]




FAD_A_2(1TDF)
TRXB_ECOLI
[Raw transfer]




FAD_A_5(4A65)
?
[Raw transfer]




FAD_C_3(1TRB)
TRXB_ECOLI
[Raw transfer]




FAD_A_5(4A5L)
?
[Raw transfer]




NAP_B_7(3F8R)
?
[Raw transfer]




NAP_C_9(3F8R)
?
[Raw transfer]




NAP_A_5(3F8R)
?
[Raw transfer]




FAD_A_3(4UP3)
?
[Raw transfer]




NAP_D_11(3F8R)
?
[Raw transfer]




CIT_C_12(3ITJ)
TRXB1_YEAST
[Raw transfer]




CIT_B_9(3ITJ)
TRXB1_YEAST
[Raw transfer]




FAD_B_7(2A87)
TRXB_MYCTU
[Raw transfer]




GOL_A_19(4YKG)
AHPF_ECOLI
[Raw transfer]




GOL_A_4(4GCM)
TRXB_STAAW
[Raw transfer]




GOL_A_4(4GCM)
TRXB_STAAW
[Raw transfer]




ACY_B_8(3F8D)
?
[Raw transfer]




ACY_B_9(3F8P)
?
[Raw transfer]




GOL_A_24(4O5Q)
AHPF_ECOLI
[Raw transfer]




71 HHSearch 97.01100%-119 - C1 -2A87 9.9 TRXB_MYCTU
1 PsiBlast_PDB 97.01100%-119 - C1 -2A87 - TRXB_MYCTU -
21 PsiBlast_CBE 94.66100%-118 - C1 -2A87 10.7 TRXB_MYCTU
9 PsiBlast_PDB 83.7450%-112 - C1 -1VDC 10.4 TRXB1_ARATH
38 PsiBlast_CBE 82.8448%-117 - C1 -2WHD 11.5 ?
80 HHSearch 82.6351%-105 - C1 -1VDC 10.5 TRXB1_ARATH
23 PsiBlast_CBE 82.5446%-109 - C1 -3ITJ 11.0 TRXB1_YEAST
18 PsiBlast_PDB 82.1548%-116 - C1 -2WHD 12.3 ?
8 PsiBlast_PDB 81.8346%-111 - C1 -3D8X - TRXB1_YEAST -
72 HHSearch 81.4646%-110 - C1 -4JNQ 13.1 ?
28 PsiBlast_CBE 81.3846%-110 - C1 -3D8X 12.0 TRXB1_YEAST
15 PsiBlast_PDB 81.3546%-118 - C1 -4JNQ 13.1 ?
5 PsiBlast_PDB 81.2048%-117 - C1 -1TDF 12.3 TRXB_ECOLI
24 PsiBlast_CBE 81.1446%-105 - C1 -3ITJ 9.6 TRXB1_YEAST
4 PsiBlast_PDB 81.0046%-103 - C1 -3ITJ 11.0 TRXB1_YEAST
73 HHSearch 80.9347%-103 * C1 *3ITJ 10.9 TRXB1_YEAST
3 PsiBlast_PDB 80.9149%-118 - C1 -1CL0 11.5 TRXB_ECOLI
2 PsiBlast_PDB 80.8549%-115 - C1 -1TDE 13.0 TRXB_ECOLI
31 PsiBlast_CBE 80.7943%-106 - C1 -4CCR 12.3 ?
34 PsiBlast_CBE 80.6743%-108 - C1 -4A65 11.7 ?
37 PsiBlast_CBE 80.5343%-107 - C1 -4UP3 11.9 ?
14 PsiBlast_PDB 80.4643%-109 - C1 -4CCR 11.6 ?
16 PsiBlast_PDB 80.4244%-106 - C1 -2Q7V 13.0 ?
36 PsiBlast_CBE 80.3044%-109 - C1 -2Q7V 12.7 ?
78 HHSearch 80.2844%-111 - C1 -2Q7V 13.0 ?
7 PsiBlast_PDB 80.1148%-116 - C1 -1TRB 12.1 TRXB_ECOLI
30 PsiBlast_CBE 80.0843%-106 - C1 -4CCR 11.8 ?
12 PsiBlast_PDB 80.0343%-110 - C1 -4CBQ 12.0 ?
35 PsiBlast_CBE 79.9243%-107 - C1 -4A5L 12.1 ?
33 PsiBlast_CBE 79.5043%-108 - C1 -4CBQ 11.8 ?
10 PsiBlast_PDB 79.2843%-108 - C1 -4A5L 12.0 ?
32 PsiBlast_CBE 79.0243%-106 - C1 -4CCQ 11.4 ?
17 PsiBlast_PDB 78.9543%-108 - C1 -4UP3 12.0 ?
13 PsiBlast_PDB 78.7143%-107 - C1 -4CCQ 12.0 ?
11 PsiBlast_PDB 78.0943%-105 - C1 -4A65 12.4 ?
82 HHSearch 77.9948%-110 - C1 -1TRB 12.1 TRXB_ECOLI
74 HHSearch 77.3744%-110 - C1 -4UP3 7.2 ?
22 PsiBlast_CBE 77.2046%-103 - C1 -3ITJ 10.3 TRXB1_YEAST
55 PsiBlast_CBE 76.8036%-110 - C1 -3F8D 3.9 ?
19 PsiBlast_PDB 76.4546%-104 - C1 -4GCM 3.2 TRXB_STAAW
51 PsiBlast_CBE 76.2137%-108 - C1 -3F8P 3.7 ?
48 PsiBlast_CBE 75.2937%-107 - C1 -3F8R 8.2 ?
77 HHSearch 75.1845%-101 - C1 -4GCM 3.2 TRXB_STAAW
47 PsiBlast_CBE 74.9237%-106 - C1 -3F8R 7.8 ?
46 PsiBlast_CBE 74.8137%-106 - C1 -3F8R 7.3 ?
45 PsiBlast_CBE 73.8637%-108 - C1 -3F8R 7.9 ?
62 PsiBlast_CBE 69.1733%-100 - C1 -4O5Q 2.9 AHPF_ECOLI
65 PsiBlast_CBE 68.9633%-100 - C1 -4YKG 3.1 AHPF_ECOLI
29 PsiBlast_CBE 56.1943% -93 - C1 -4CCR 12.0 ?