@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA1470: (2016-01-29 )
MPDITQAAIVTGASRGIGRAIARRLAADGFAVAVNYASNQAMADEVVAEIVAAGGAAIAVQGDVASAEDMDKLFEATRGAFGRIDVVVNSAGTMPYLKIADGDLEGFDRVIRTNLRGAFIVLGLAARHVERGGRIIALSTSVIARALPSYGPYIASKSGVEGLVHVLANELRGQDIRVNAVAPGPVATELFFNGKSAEQIDQIARLAPLERLGEPDEIAAAVSFLAGPDGAWVNSQVLRVNGGFA

Atome Classification :

(26 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAP_C_7(4DMM)
?
[Raw transfer]




NDP_A_3(3SJ7)
?
[Raw transfer]




NAP_B_6(4DMM)
?
[Raw transfer]




NDP_B_6(3SJ7)
?
[Raw transfer]




NAP_D_8(4DMM)
?
[Raw transfer]




GOL_A_4(4JIG)
?
[Raw transfer]




PEG_A_6(3OSU)
FABG_STAAM
[Raw transfer]




35 PsiBlast_CBE 84.0138%-102 - C1 -4FJ0 - ? -
34 PsiBlast_CBE 83.2138%-104 - C1 -4FJ0 - ? -
31 PsiBlast_CBE 83.1938%-104 - C1 -4FJ1 - ? -
32 PsiBlast_CBE 82.5738%-102 - C1 -4FJ1 - ? -
45 PsiBlast_CBE 82.3638%-101 - C1 -3QWF - ? -
43 PsiBlast_CBE 82.1838%-102 - C1 -3QWF - ? -
46 PsiBlast_CBE 81.8038%-100 - C1 -3QWF - ? -
28 PsiBlast_CBE 81.6038%-101 - C1 -4FJ2 - ? -
12 PsiBlast_PDB 81.6038%-104 - C1 -4FJ0 - ? -
44 PsiBlast_CBE 81.4738%-103 - C1 -3QWF - ? -
9 PsiBlast_PDB 81.4738%-103 - C1 -3QWI - ? -
8 PsiBlast_PDB 81.2738%-103 - C1 -3QWF - ? -
30 PsiBlast_CBE 81.1438%-102 - C1 -4FJ1 - ? -
39 PsiBlast_CBE 81.0238%-101 - C1 -3QWH - ? -
50 PsiBlast_CBE 80.8839%-103 * C1 *3SJ7 11.8 ?
48 PsiBlast_CBE 80.7438%-104 - C1 -3QWF - ? -
36 PsiBlast_CBE 80.4638%-100 - C1 -3QWI - ? -
13 PsiBlast_PDB 80.3738%-103 - C1 -4FJ1 - ? -
11 PsiBlast_PDB 80.3038%-101 - C1 -4FIZ - ? -
27 PsiBlast_CBE 80.2338% -99 - C1 -4FJ2 - ? -
18 PsiBlast_PDB 78.9439%-104 - C1 -3SJ7 10.1 ?
53 PsiBlast_CBE 78.7042%-103 - C1 -4DMM 11.3 ?
54 PsiBlast_CBE 78.3242%-100 - C1 -4DMM 9.6 ?
19 PsiBlast_PDB 77.6440%-101 - C1 -3OSU 2.3 FABG_STAAM
52 PsiBlast_CBE 77.5342%-102 - C1 -4DMM 11.1 ?
72 PsiBlast_CBE 70.1438% -94 - C1 -4JIG 2.2 ?