@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA4067: (2016-02-23 )
MRKSWLTASLLALTVASPFAAADIQGHKAGDFIIRGGFATVDPDDSSSDIKLDGAKQRGTKATVDSDTQLGLTFTYMFADKWGVELVAATPFNHQVDVKGLGPGLDGKLADIKQLPPTLLLQYYPMGGTNSAFQPYGGLGVNYTTFFDEDLASNRKAQGFSSMKLQDSWGLAGELGFDYMLNEHALFNMAVWYMDIDTKASINGPSALGVNKTKVDVDVDPWVYMIGFGYKF

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

C8E_X_8(2X27)
?
[Raw transfer]




C8E_X_8(2X27)
?
[Raw transfer]




C8E_J_10(2F1T)
OMPW_ECOLI
[Raw transfer]




C8E_M_13(2F1T)
OMPW_ECOLI
[Raw transfer]




1 PsiBlast_PDB 98.10100% -55 - C5 -2X27 3.3 ?
26 HHSearch 97.80100% -60 - C5 -2X27 3.3 ?
17 PsiBlast_CBE 74.1945% -58 - C5 -2F1V - OMPW_ECOLI -
20 PsiBlast_CBE 74.1345% -57 - C5 -2F1V - OMPW_ECOLI -
3 PsiBlast_PDB 74.0245% -57 - C5 -2F1V - OMPW_ECOLI -
18 PsiBlast_CBE 73.9745% -58 - C5 -2F1V - OMPW_ECOLI -
19 PsiBlast_CBE 73.8145% -58 - C5 -2F1V - OMPW_ECOLI -
24 HHSearch 73.2347% -61 - C5 -2F1V - OMPW_ECOLI -
16 PsiBlast_CBE 73.1445% -58 - C5 -2F1V - OMPW_ECOLI -
2 PsiBlast_PDB 70.8645% -59 - C5 -2F1T 2.8 OMPW_ECOLI
22 PsiBlast_CBE 70.5545% -61 - C5 -2F1T 3.7 OMPW_ECOLI
21 PsiBlast_CBE 70.0645% -60 - C5 -2F1T - OMPW_ECOLI -
51 Fugue 54.7320% -69 - C4 -2B2A - TERT_TETTH -
48 Fugue 47.3718% -23 - C5 -1P4T - ? -
45 Fugue 45.388% -31 - C5 -2LHF - ? -
25 HHSearch 44.7713% -51 - C5 -2K0L - OMPA_KLEPN -
30 HHSearch 43.9820% -32 - C5 -3QRA - ? -
32 HHSearch 42.8811% -40 - C5 -2LHF - ? -
28 HHSearch 40.1517% -18 - C5 -1P4T - ? -
53 Fugue 38.8018% -41 - C5 -1DDT - ? -