@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B2R8C2_HUMAN: (2017-06-01 )
WFFGAIRRSDAEKQLLYSENKTGSFLIRESESQKGEFSLSVLDGAVVKHYRIKRLDEGGFFLTRRRIFSTLNEFVSHY

Atome Classification :

(102 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_I_3(1BHF)

[Raw transfer]




876_A_2(1O4B)

[Raw transfer]




493_B_2(1O49)

[Raw transfer]




787_B_2(1O4R)

[Raw transfer]




UR2_A_2(1SKJ)

[Raw transfer]




256_B_2(1O4Q)

[Raw transfer]




CC0_A_2(1IJR)
LCK_HUMAN
[Raw transfer]




687_B_2(1O45)

[Raw transfer]




852_B_2(1O44)

[Raw transfer]




CIT_B_2(1O4L)

[Raw transfer]




791_B_2(1O4P)

[Raw transfer]




843_B_2(1O42)

[Raw transfer]




853_A_2(1O48)

[Raw transfer]




772_B_2(1O4H)

[Raw transfer]




262_B_2(1O4D)

[Raw transfer]




OXD_B_2(1O4N)

[Raw transfer]




299_B_2(1O4E)

[Raw transfer]




HPS_C_3(1O4O)

[Raw transfer]




MLA_B_2(1O4M)

[Raw transfer]




1C5_A_2(1BKM)

[Raw transfer]




PSN_B_2(1O4K)

[Raw transfer]




197_B_2(1O4A)

[Raw transfer]




PHS_B_4(1LKL)
?
[Raw transfer]




903_B_2(1O46)

[Raw transfer]




219_B_2(1O4I)

[Raw transfer]




I59_A_2(1O4G)

[Raw transfer]




821_B_2(1O43)

[Raw transfer]




PTC_D_6(1IS0)

[Raw transfer]




PHS_B_3(1LCK)
LCK_HUMAN
[Raw transfer]




300_B_2(1O41)

[Raw transfer]




822_B_2(1O47)

[Raw transfer]




IS2_A_2(1O4J)

[Raw transfer]




790_B_2(1O4F)

[Raw transfer]




CC1_D_4(1FBZ)
?
[Raw transfer]




CC1_C_3(1FBZ)
LCK_HUMAN
[Raw transfer]




CHAIN_I_2(1BHF)

[Raw transfer]

-

CHAIN_D_4(1A09)

[Raw transfer]

-

CHAIN_C_2(1A09)
SRC_HUMAN
[Raw transfer]

-

CHAIN_K_9(1X27)
?
[Raw transfer]

-

CHAIN_D_4(1A1A)

[Raw transfer]

-

CHAIN_C_3(1A1C)
SRC_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A1E)

[Raw transfer]

-

CHAIN_D_4(1A1B)

[Raw transfer]

-

CHAIN_C_3(1A1E)
SRC_HUMAN
[Raw transfer]

-

CHAIN_C_2(1A1B)
SRC_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A1C)

[Raw transfer]

-

CHAIN_B_2(1SHA)

[Raw transfer]

-

CHAIN_B_2(1CWE)
?
[Raw transfer]

-

CHAIN_J_8(1X27)
?
[Raw transfer]

-

CHAIN_N_12(1X27)
?
[Raw transfer]

-

CHAIN_C_2(1A08)
SRC_HUMAN
[Raw transfer]

-

CHAIN_M_11(1X27)
?
[Raw transfer]

-

CHAIN_P_2(1CWD)
?
[Raw transfer]

-

CHAIN_C_2(1A1A)
SRC_HUMAN
[Raw transfer]

-

CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A08)

[Raw transfer]

-

CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_B_2(1SHD)

[Raw transfer]

-

CHAIN_D_4(1A07)

[Raw transfer]

-

ACE_B_3(1LKL)
?
[Raw transfer]




CHAIN_D_4(1CWE)
?
[Raw transfer]

-

CHAIN_I_7(1X27)

[Raw transfer]

-

CHAIN_B_2(1SHB)

[Raw transfer]

-

CHAIN_L_10(1X27)
?
[Raw transfer]

-

CHAIN_D_2(1SPS)
SRC_RSVSA
[Raw transfer]

-

CHAIN_B_2(1KC2)

[Raw transfer]

-

CHAIN_D_4(1P13)
SRC_CHICK
[Raw transfer]

-

CHAIN_E_4(1SPS)
SRC_RSVSA
[Raw transfer]

-

CHAIN_A_1(1HCS)

[Raw transfer]

-

CHAIN_B_2(1F1W)

[Raw transfer]

-

CHAIN_B_2(1LCJ)
LCK_HUMAN
[Raw transfer]

-

CHAIN_F_6(1SPS)

[Raw transfer]

-

EDO_A_6(4U17)
FYN_HUMAN
[Raw transfer]




CHAIN_B_2(1LKL)
?
[Raw transfer]

-

CHAIN_C_2(1A07)
SRC_HUMAN
[Raw transfer]

-

CHAIN_B_2(3WA4)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_C_2(1IS0)
SRC_RSVSA
[Raw transfer]

-

CHAIN_B_2(1LCK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_C_3(1P13)

[Raw transfer]

-

CHAIN_A_1(1HCT)

[Raw transfer]

-

CHAIN_C_3(1NZV)

[Raw transfer]

-

CHAIN_D_4(1IS0)

[Raw transfer]

-

CHAIN_M_6(3PQZ)
GRB7_HUMAN
[Raw transfer]

-

CHAIN_P_2(1AOT)

[Raw transfer]

-

CHAIN_C_3(1NZL)

[Raw transfer]

-

CHAIN_P_2(1AOU)

[Raw transfer]

-

270 HHSearch 86.8485%-163 - C1 -2DLY Calc...
1 PsiBlast_PDB 86.5584%-163 - C1 -2DLY - -
197 PsiBlast_CBE 77.8246%-158 - C1 -1JYR - GRB2_HUMAN -
136 PsiBlast_CBE 77.6946%-156 - C1 -1BMB - GRB2_HUMAN -
183 PsiBlast_CBE 77.4846%-164 - C1 -3MXY - GRB2_HUMAN -
200 PsiBlast_CBE 77.4246%-156 - C1 -3WA4 - GRB2_HUMAN -
199 PsiBlast_CBE 77.4246%-157 * C1 *1JYQ - GRB2_HUMAN -
151 PsiBlast_CBE 77.3446%-160 - C1 -3N8M - GRB2_HUMAN -
155 PsiBlast_CBE 76.9646%-166 - C1 -3IN7 - GRB2_HUMAN -
147 PsiBlast_CBE 76.8946%-157 - C1 -3S8N - GRB2_HUMAN -
181 PsiBlast_CBE 76.8746%-149 - C1 -1TZE - GRB2_HUMAN -
157 PsiBlast_CBE 76.8746%-169 - C1 -3IMJ - GRB2_HUMAN -
154 PsiBlast_CBE 76.8446%-171 - C1 -3IN7 - GRB2_HUMAN -
149 PsiBlast_CBE 76.7346%-168 - C1 -3OVE - GRB2_HUMAN -
145 PsiBlast_CBE 76.6446%-167 - C1 -4P9V - GRB2_HUMAN -
198 PsiBlast_CBE 76.6346%-159 - C1 -1JYQ - GRB2_HUMAN -
138 PsiBlast_CBE 76.5546%-163 - C1 -3N84 - GRB2_HUMAN -
146 PsiBlast_CBE 76.4946%-156 - C1 -3S8O - GRB2_HUMAN -
164 PsiBlast_CBE 76.2546%-161 - C1 -3C7I - GRB2_HUMAN -
148 PsiBlast_CBE 76.1446%-158 - C1 -3S8L - GRB2_HUMAN -
277 HHSearch 76.0347%-158 - C1 -3WA4 7.9 GRB2_HUMAN
49 PsiBlast_CBE 71.2456% -15 - C1 -1X27 5.0 ?
57 PsiBlast_CBE 71.0455% -46 - C1 -1IJR 8.2 LCK_HUMAN
51 PsiBlast_CBE 70.8756% -26 - C1 -1X27 4.2 ?
59 PsiBlast_CBE 70.1355% -43 - C1 -1FBZ 5.7 LCK_HUMAN
50 PsiBlast_CBE 69.7056% -38 - C1 -1X27 5.6 ?
53 PsiBlast_CBE 69.4556% -21 - C1 -1X27 4.2
274 HHSearch 69.4260% -22 - C1 -1LKK 7.0 LCK_HUMAN
52 PsiBlast_CBE 69.4256% -19 - C1 -1X27 6.2 ?
47 PsiBlast_CBE 68.3056% -22 - C1 -1LKK 7.0 LCK_HUMAN
48 PsiBlast_CBE 68.2556% -29 - C1 -1X27 5.0 ?
98 PsiBlast_CBE 67.4348% -22 - C1 -1A09 5.4
100 PsiBlast_CBE 67.3048% -28 - C1 -1A08 6.1
96 PsiBlast_CBE 67.0048% -28 - C1 -1A1B 5.6
55 PsiBlast_CBE 66.6956% -35 - C1 -1CWE 5.1 ?
58 PsiBlast_CBE 66.5655% -47 - C1 -1FBZ 6.1 ?
46 PsiBlast_CBE 66.5056% -13 - C1 -1LKL 4.0 ?
56 PsiBlast_CBE 66.4456% -30 - C1 -1CWD 4.1 ?
92 PsiBlast_CBE 66.4148% -22 - C1 -1A1E 6.6
94 PsiBlast_CBE 66.3348% -26 - C1 -1A1C 7.2
110 PsiBlast_CBE 66.1748% -22 - C1 -1O4L 3.8
79 PsiBlast_CBE 66.1249% -21 - C1 -1SHB 4.0
102 PsiBlast_CBE 66.0248% -19 - C1 -1A07 3.3
123 PsiBlast_CBE 65.9948% -15 - C1 -1O45 6.7
44 PsiBlast_CBE 65.8356% -21 - C1 -1LCK 4.0 LCK_HUMAN
43 PsiBlast_CBE 65.6856% -21 - C1 -1LCJ 4.6 LCK_HUMAN
42 PsiBlast_CBE 65.6156% -27 - C1 -1BHF 4.9
124 PsiBlast_CBE 65.3348% -19 - C1 -1O44 8.5
67 PsiBlast_CBE 65.2849% -11 - C1 -1A1A 6.4
80 PsiBlast_CBE 65.1749% -21 - C1 -1SHA 6.7
89 PsiBlast_CBE 65.1548% -43 - C1 -1SHD 6.0
101 PsiBlast_CBE 65.0948% -24 - C1 -1A08 5.6 SRC_HUMAN
93 PsiBlast_CBE 64.9148% -33 - C1 -1A1E 7.1 SRC_HUMAN
54 PsiBlast_CBE 64.8256% -32 - C1 -1CWE 4.5 ?
114 PsiBlast_CBE 64.7348% -18 - C1 -1O4H 3.9
103 PsiBlast_CBE 64.6948% -31 - C1 -1A07 3.7 SRC_HUMAN
68 PsiBlast_CBE 64.6849% -14 - C1 -1A1A 4.8 SRC_HUMAN
97 PsiBlast_CBE 64.5648% -25 - C1 -1A1B 6.2 SRC_HUMAN
76 PsiBlast_CBE 64.3949% -17 - C1 -1SPS 4.2 SRC_RSVSA
126 PsiBlast_CBE 64.3548% -10 - C1 -1O42 6.9
113 PsiBlast_CBE 64.3548% -23 - C1 -1O4I 2.5
125 PsiBlast_CBE 64.3448% -13 - C1 -1O43 6.0
73 PsiBlast_CBE 64.1849% -22 - C1 -1IS0 4.5
77 PsiBlast_CBE 64.1549% -12 - C1 -1SPS 4.3 SRC_RSVSA
95 PsiBlast_CBE 63.9748% -17 - C1 -1A1C 6.8 SRC_HUMAN
99 PsiBlast_CBE 63.8048% -27 - C1 -1A09 5.4 SRC_HUMAN
86 PsiBlast_CBE 63.7049% -36 - C1 -1P13 5.3
109 PsiBlast_CBE 63.5148% -22 - C1 -1O4M 3.0
85 PsiBlast_CBE 63.5049% -19 - C1 -1SKJ 7.0
117 PsiBlast_CBE 63.4248% -12 - C1 -1O4B 5.9
134 PsiBlast_CBE 63.4148% -15 - C1 -1O4F 2.3
132 PsiBlast_CBE 63.4146% -80 - C1 -1KC2 5.9
121 PsiBlast_CBE 63.3948% -7 - C1 -1O47 7.6
120 PsiBlast_CBE 63.3948% -16 - C1 -1O48 8.2
131 PsiBlast_CBE 63.2748% -21 - C1 -1F1W 5.7
118 PsiBlast_CBE 63.1248% -16 - C1 -1O4A 6.8
111 PsiBlast_CBE 63.1248% -23 - C1 -1O4K 3.4
127 PsiBlast_CBE 63.0648% -23 - C1 -1O41 2.5
87 PsiBlast_CBE 62.9349% -24 - C1 -1P13 6.0 SRC_CHICK
107 PsiBlast_CBE 62.8248% -17 - C1 -1O4O 2.9
106 PsiBlast_CBE 62.7048% -9 - C1 -1O4P 4.7
88 PsiBlast_CBE 62.7049% -18 - C1 -1BKM 6.1
83 PsiBlast_CBE 62.6549% -24 - C1 -1NZL 5.8
105 PsiBlast_CBE 62.4748% -19 - C1 -1O4Q 3.9
81 PsiBlast_CBE 62.4349% -19 - C1 -1NZV 6.8
119 PsiBlast_CBE 62.1448% -15 - C1 -1O49 6.4
115 PsiBlast_CBE 62.0448% -21 - C1 -1O4E 2.7
91 PsiBlast_CBE 61.9048% -22 - C1 -1HCS 3.9
75 PsiBlast_CBE 61.8549% 5 - C1 -1SPS 3.6
74 PsiBlast_CBE 61.8449% -27 - C1 -1IS0 2.6 SRC_RSVSA
104 PsiBlast_CBE 61.8348% -25 - C1 -1O4R 5.0
122 PsiBlast_CBE 61.7148% -13 - C1 -1O46 7.7
108 PsiBlast_CBE 61.3348% -20 - C1 -1O4N 3.4
133 PsiBlast_CBE 61.1548% -17 - C1 -1O4G 3.9
116 PsiBlast_CBE 61.1148% -15 - C1 -1O4D 2.8
112 PsiBlast_CBE 60.3248% -17 - C1 -1O4J 2.9
90 PsiBlast_CBE 59.8148% -18 - C1 -1HCT 3.1
285 Fugue 56.7959% 96 - C1 -1LKK 7.6 LCK_HUMAN
64 PsiBlast_CBE 53.8451% 17 - C1 -1AOU 4.7
65 PsiBlast_CBE 51.3951% 14 - C1 -1AOT 2.0
272 HHSearch 50.4931%-105 - C1 -3PQZ 2.2 GRB7_HUMAN
63 PsiBlast_CBE 44.9751% -13 - C1 -4U17 3.2 FYN_HUMAN