@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VMC3: (2017-11-07 )
MKPDISELSVEELKRLQEEAEALIASKKDQAIEDAYNQIIEIAENVGFSVEQLLEFGAQKRKKTTRKSVEPRYRNKNNAEETWTGRGKQPRWLVAEIEKGAKLEDFLI

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NACID_C_3(2LEV)
?
[Raw transfer]

-

NACID_B_2(2LEV)
?
[Raw transfer]

-

NACID_C_3(2LEV)
?
[Raw transfer]

-

24 Fugue 69.4937% 26 - C2 -2LEV 5.4 ?
13 PsiBlast_PDB 63.5931%-174 - C2 -5JBH - RS10_PYRFU -
36 HHSearch 63.4946% 15 - C2 -2LEV 5.4 ?
32 Fugue 62.8820% 27 - C2 -4Z24 - YR135_MIMIV -
12 PsiBlast_PDB 62.6831%-174 - C2 -5JB3 - RS10_PYRFU -
1 PsiBlast_PDB 62.4450% 17 - C2 -2LEV - ? -
14 PsiBlast_PDB 59.7330% -30 - C2 -1YI8 - SYW2_DEIRA -
17 PsiBlast_PDB 58.8530% -34 - C2 -2A4M - SYW2_DEIRA -
16 PsiBlast_PDB 58.7030% -30 - C2 -1YID - SYW2_DEIRA -
37 HHSearch 58.6447% -23 - C2 -2L92 - BV3F_BURVG -
23 PsiBlast_CBE 58.2236%-124 - C2 -4LYP - ? -
3 PsiBlast_PDB 57.9743% -44 - C2 -2L93 - HNS_SALTY -
11 PsiBlast_PDB 57.8636%-121 - C2 -4LYP - ? -
7 PsiBlast_PDB 57.7436%-130 - C2 -4LYQ - ? -
22 PsiBlast_CBE 57.3936%-126 - C2 -4NRR - ? -
8 PsiBlast_PDB 56.6536%-135 - C2 -4NRR - ? -
10 PsiBlast_PDB 56.5636%-117 - C2 -4LYR - ? -
15 PsiBlast_PDB 56.2630% -32 - C2 -1YIA - SYW2_DEIRA -
2 PsiBlast_PDB 56.1335% -8 - C2 -2LRX - -
25 Fugue 55.7334% 54 - C2 -2L92 - BV3F_BURVG -