@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VMT6: (2017-11-10 )
MVAQIRIGQGMDVHAFEEGKFVTLAGVQIPHTHGLKAHSDGDVVLHALCDALLGALALGDIGQHFPDTDPEFKGADSRVLLKHVYQLILDRGYHLNNADITVACERPKLAKYNLEMRQSIADVLNVDLNQISIKATTTEKLGFTGRQEGILATATVLISH

Atome Classification :

(97 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SUD_D_4(1U43)
ISPF_ECOLI
[Raw transfer]




CDM_A_3(1U40)
ISPF_ECOLI
[Raw transfer]




1AA_C_15(2AMT)
ISPF_ECOLI
[Raw transfer]




CTP_B_6(3IEW)
ISPF_BURPS
[Raw transfer]




1AA_E_17(2AMT)
ISPF_ECOLI
[Raw transfer]




CDP_A_4(1U3L)
ISPF_ECOLI
[Raw transfer]




1AA_A_13(2AMT)
ISPF_ECOLI
[Raw transfer]




1AA_E_18(2AMT)
ISPF_ECOLI
[Raw transfer]




1AA_C_14(2AMT)
ISPF_ECOLI
[Raw transfer]




C_A_3(1W55)
ISPDF_CAMJE
[Raw transfer]




C5P_C_15(1H48)
ISPF_ECOLI
[Raw transfer]




829_B_8(3KE1)
ISPF_BURP1
[Raw transfer]




AO9_A_9(3Q8H)
ISPF_BURPS
[Raw transfer]




GOL_A_4(3GHZ)
ISPF_SALTY
[Raw transfer]




GOL_C_9(3GHZ)
ISPF_SALTY
[Raw transfer]




C5P_A_9(1H48)
ISPF_ECOLI
[Raw transfer]




1AA_D_19(2AMT)
ISPF_ECOLI
[Raw transfer]




829_A_5(3KE1)
ISPF_BURP1
[Raw transfer]




CDP_A_4(1YQN)
ISPF_ECOLI
[Raw transfer]




AO9_B_11(3Q8H)
ISPF_BURPS
[Raw transfer]




AO9_A_5(3Q8H)
ISPF_BURPS
[Raw transfer]




C5P_F_26(1H48)
ISPF_ECOLI
[Raw transfer]




829_C_10(3KE1)
ISPF_BURP1
[Raw transfer]




CDP_C_9(3IEW)
ISPF_BURPS
[Raw transfer]




C5P_F_19(1H47)
ISPF_ECOLI
[Raw transfer]




C5P_C_12(1H47)
ISPF_ECOLI
[Raw transfer]




C5P_B_8(3F0G)
ISPF_BURP1
[Raw transfer]




F01_A_5(3ELC)
ISPF_ECOLI
[Raw transfer]




CTN_C_24(3T80)
ISPF_SALTY
[Raw transfer]




C5P_E_14(3F0G)
ISPF_BURP1
[Raw transfer]




C5P_B_9(5IWY)
ISPF_BACSU
[Raw transfer]




C5P_A_9(1H47)
ISPF_ECOLI
[Raw transfer]




C5P_D_16(1H47)
ISPF_ECOLI
[Raw transfer]




CTN_B_17(3T80)
ISPF_SALTY
[Raw transfer]




C5P_E_17(1H47)
ISPF_ECOLI
[Raw transfer]




CTN_B_9(3P10)
ISPF_BURP1
[Raw transfer]




C5P_A_8(5IWY)
ISPF_BACSU
[Raw transfer]




C5P_F_16(3F0G)
ISPF_BURP1
[Raw transfer]




C5P_A_8(5IWY)
ISPF_BACSU
[Raw transfer]




C5P_C_11(5IWY)
ISPF_BACSU
[Raw transfer]




C5P_B_10(1H47)
ISPF_ECOLI
[Raw transfer]




C5P_A_5(2PMP)
ISPF_ARATH
[Raw transfer]




CTN_B_9(3P0Z)
ISPF_BURP1
[Raw transfer]




I5A_B_9(3K2X)
ISPF_BURP1
[Raw transfer]




F01_B_7(3ELC)
ISPF_ECOLI
[Raw transfer]




C5P_C_8(3F0F)
ISPF_BURP1
[Raw transfer]




C5P_C_10(3F0G)
ISPF_BURP1
[Raw transfer]




CTN_B_11(3QHD)
ISPF_BURP1
[Raw transfer]




C5P_D_19(1H48)
ISPF_ECOLI
[Raw transfer]




C5P_A_3(1JY8)
ISPF_ECOLI
[Raw transfer]




C5P_B_12(1H48)
ISPF_ECOLI
[Raw transfer]




CDP_A_5(3IEW)
ISPF_BURPS
[Raw transfer]




C5P_D_12(3F0G)
ISPF_BURP1
[Raw transfer]




C5P_A_3(1JY8)
ISPF_ECOLI
[Raw transfer]




I5A_A_5(3K2X)
ISPF_BURP1
[Raw transfer]




CTN_A_7(3P0Z)
ISPF_BURP1
[Raw transfer]




C5P_A_5(5B8F)
ISPF_PSEAE
[Raw transfer]




CDP_A_4(4C81)
ISPF_PLAF7
[Raw transfer]




C5P_C_14(5B8F)
ISPF_PSEAE
[Raw transfer]




CTN_C_12(3P10)
ISPF_BURP1
[Raw transfer]




C_B_8(3IEQ)
ISPF_BURP1
[Raw transfer]




CTN_A_6(3QHD)
ISPF_BURP1
[Raw transfer]




GOL_A_4(3F0F)
ISPF_BURP1
[Raw transfer]




CTN_A_6(3P10)
ISPF_BURP1
[Raw transfer]




CAR_A_8(3ERN)
ISPF_ECOLI
[Raw transfer]




CAR_E_16(3ERN)
ISPF_ECOLI
[Raw transfer]




F01_C_9(3ELC)
ISPF_ECOLI
[Raw transfer]




CTN_C_13(3QHD)
ISPF_BURP1
[Raw transfer]




CTN_C_12(3P0Z)
ISPF_BURP1
[Raw transfer]




C_A_4(3IEQ)
ISPF_BURP1
[Raw transfer]




C_C_10(3IEQ)
ISPF_BURP1
[Raw transfer]




I5A_C_11(3K2X)
ISPF_BURP1
[Raw transfer]




C5P_F_15(5IWY)
ISPF_BACSU
[Raw transfer]




CAR_D_15(3ERN)
ISPF_ECOLI
[Raw transfer]




C5P_E_23(1H48)
ISPF_ECOLI
[Raw transfer]




CTN_A_10(3T80)
ISPF_SALTY
[Raw transfer]




C5P_B_8(5B8F)
ISPF_PSEAE
[Raw transfer]




CAR_C_13(3ERN)
ISPF_ECOLI
[Raw transfer]




C5P_B_8(5B8F)
ISPF_PSEAE
[Raw transfer]




CAR_B_9(3ERN)
ISPF_ECOLI
[Raw transfer]




535_B_9(3K14)
ISPF_BURP1
[Raw transfer]




535_A_5(3K14)
ISPF_BURP1
[Raw transfer]




535_C_11(3K14)
ISPF_BURP1
[Raw transfer]




HHV_C_10(3JVH)
ISPF_BURP1
[Raw transfer]




HHV_A_5(3JVH)
ISPF_BURP1
[Raw transfer]




717_A_5(3IKF)
ISPF_BURPS
[Raw transfer]




717_A_6(3MBM)
ISPF_BURP1
[Raw transfer]




HHV_B_8(3JVH)
ISPF_BURP1
[Raw transfer]




717_C_11(3MBM)
ISPF_BURP1
[Raw transfer]




717_B_10(3MBM)
ISPF_BURP1
[Raw transfer]




717_B_10(3IKF)
ISPF_BURPS
[Raw transfer]




717_A_6(3IKF)
ISPF_BURPS
[Raw transfer]




MPD_C_14(3RE3)
ISPF_FRATT
[Raw transfer]




137 HHSearch 91.9759%-148 - C8 -5B8F 2.9 ISPF_PSEAE
21 PsiBlast_CBE 90.7160%-150 - C8 -5B8F 2.9 ISPF_PSEAE
22 PsiBlast_CBE 90.5360%-145 - C8 -5B8F 3.2 ISPF_PSEAE
138 HHSearch 90.0859%-140 * C8 *5B8F 3.3 ISPF_PSEAE
1 PsiBlast_PDB 89.3660%-142 - C8 -5B8F - ISPF_PSEAE -
134 HHSearch 89.0855%-135 - C8 -5IWY 3.3 ISPF_BACSU
2 PsiBlast_PDB 88.7158%-140 - C8 -1T0A - ISPF_SHEON -
43 PsiBlast_CBE 88.2554%-143 - C8 -1H48 3.0 ISPF_ECOLI
23 PsiBlast_CBE 88.2455%-139 - C8 -5IWY - ISPF_BACSU -
64 PsiBlast_CBE 88.2155%-140 - C8 -2AMT 3.5 ISPF_ECOLI
50 PsiBlast_CBE 88.2154%-137 - C8 -1H47 3.3 ISPF_ECOLI
26 PsiBlast_CBE 88.1755%-139 - C8 -5IWY 3.3 ISPF_BACSU
9 PsiBlast_PDB 88.1055%-140 - C8 -3T80 2.9 ISPF_SALTY
47 PsiBlast_CBE 88.0654%-137 - C8 -1H47 3.2 ISPF_ECOLI
4 PsiBlast_PDB 88.0455%-137 - C8 -5IWY 3.4 ISPF_BACSU
8 PsiBlast_PDB 87.9955%-138 - C8 -3GHZ 3.3 ISPF_SALTY
46 PsiBlast_CBE 87.8654%-141 - C8 -1H48 3.0 ISPF_ECOLI
3 PsiBlast_PDB 87.8555%-138 - C8 -5IWX - ISPF_BACSU -
51 PsiBlast_CBE 87.7354%-136 - C8 -1H47 3.1 ISPF_ECOLI
44 PsiBlast_CBE 87.7354%-139 - C8 -1H48 2.8 ISPF_ECOLI
45 PsiBlast_CBE 87.7154%-141 - C8 -1H48 3.0 ISPF_ECOLI
27 PsiBlast_CBE 87.6655%-139 - C8 -5IWY 3.2 ISPF_BACSU
48 PsiBlast_CBE 87.6554%-135 - C8 -1H47 3.1 ISPF_ECOLI
54 PsiBlast_CBE 87.5654%-140 - C8 -3ERN 2.8 ISPF_ECOLI
57 PsiBlast_CBE 87.4954%-141 - C8 -3ELC 3.2 ISPF_ECOLI
60 PsiBlast_CBE 87.4255%-141 - C8 -2AMT 4.3 ISPF_ECOLI
123 Fugue 87.3954%-139 - C8 -1JY8 3.2 ISPF_ECOLI
62 PsiBlast_CBE 87.3255%-136 - C8 -2AMT 4.0 ISPF_ECOLI
18 PsiBlast_PDB 87.1955%-140 - C8 -1JY8 3.2 ISPF_ECOLI
24 PsiBlast_CBE 87.1455%-148 - C8 -5IWY 2.9 ISPF_BACSU
15 PsiBlast_PDB 87.1254%-141 - C8 -3ERN 2.6 ISPF_ECOLI
40 PsiBlast_CBE 87.1155%-136 - C8 -3GHZ 2.3 ISPF_SALTY
61 PsiBlast_CBE 87.1055%-135 - C8 -2AMT 4.1 ISPF_ECOLI
56 PsiBlast_CBE 87.0554%-144 - C8 -3ERN 2.6 ISPF_ECOLI
58 PsiBlast_CBE 87.0354%-143 - C8 -3ELC 3.1 ISPF_ECOLI
20 PsiBlast_PDB 86.9155%-141 - C8 -1U3L 3.6 ISPF_ECOLI
13 PsiBlast_PDB 86.8154%-141 - C8 -3ELC 3.2 ISPF_ECOLI
63 PsiBlast_CBE 86.7855%-139 - C8 -2AMT 3.4 ISPF_ECOLI
42 PsiBlast_CBE 86.7354%-139 - C8 -1H48 3.1 ISPF_ECOLI
10 PsiBlast_PDB 86.5654%-138 - C8 -1H47 3.3 ISPF_ECOLI
11 PsiBlast_PDB 86.5054%-141 - C8 -1H48 3.0 ISPF_ECOLI
55 PsiBlast_CBE 86.4154%-143 - C8 -3ERN 3.1 ISPF_ECOLI
49 PsiBlast_CBE 86.2554%-140 - C8 -1H47 3.1 ISPF_ECOLI
65 PsiBlast_CBE 86.2255%-137 - C8 -1U43 2.8 ISPF_ECOLI
52 PsiBlast_CBE 86.0154%-153 - C8 -3ERN 3.0 ISPF_ECOLI
68 PsiBlast_CBE 85.9153%-135 - C8 -1YQN 3.5 ISPF_ECOLI
147 HHSearch 85.8750%-148 - C8 -1W55 3.5 ISPDF_CAMJE
66 PsiBlast_CBE 85.8555%-138 - C8 -1U40 3.3 ISPF_ECOLI
59 PsiBlast_CBE 85.8055%-134 - C8 -2AMT 4.1 ISPF_ECOLI
38 PsiBlast_CBE 85.2955%-140 - C8 -3T80 3.1 ISPF_SALTY
133 HHSearch 84.3449%-141 - C8 -3IKF 3.4 ISPF_BURPS
39 PsiBlast_CBE 83.1955%-142 - C8 -3T80 3.0 ISPF_SALTY
107 PsiBlast_CBE 83.1250%-141 - C8 -3F0G 3.3 ISPF_BURP1
132 HHSearch 83.1041%-149 - C8 -2PMP 3.4 ISPF_ARATH
92 PsiBlast_CBE 82.9750%-143 - C8 -3K14 1.8 ISPF_BURP1
101 PsiBlast_CBE 82.9550%-146 - C8 -3IEQ 3.5 ISPF_BURP1
69 PsiBlast_CBE 82.8150%-139 - C8 -3QHD 3.4 ISPF_BURP1
76 PsiBlast_CBE 82.7850%-143 - C8 -3P10 3.6 ISPF_BURP1
77 PsiBlast_CBE 82.7150%-140 - C8 -3P10 3.3 ISPF_BURP1
80 PsiBlast_CBE 82.7050%-145 - C8 -3P0Z 3.3 ISPF_BURP1
71 PsiBlast_CBE 82.6650%-143 - C8 -3QHD 3.5 ISPF_BURP1
95 PsiBlast_CBE 82.6050%-142 - C8 -3JVH 2.6 ISPF_BURP1
104 PsiBlast_CBE 82.5750%-139 - C8 -3F0G 3.4 ISPF_BURP1
109 PsiBlast_CBE 82.2850%-137 - C8 -3F0F 3.2 ISPF_BURP1
78 PsiBlast_CBE 82.2650%-147 - C8 -3P0Z 3.2 ISPF_BURP1
110 PsiBlast_CBE 82.1450%-136 - C8 -3F0F 2.1 ISPF_BURP1
106 PsiBlast_CBE 82.0450%-142 - C8 -3F0G 3.1 ISPF_BURP1
73 PsiBlast_CBE 81.9350%-140 - C8 -3Q8H 3.4 ISPF_BURPS
72 PsiBlast_CBE 81.8550%-139 - C8 -3Q8H 3.7 ISPF_BURPS
93 PsiBlast_CBE 81.7750%-140 - C8 -3JVH 3.1 ISPF_BURP1
98 PsiBlast_CBE 81.7350%-142 - C8 -3IEW 4.3 ISPF_BURPS
82 PsiBlast_CBE 81.7050%-142 - C8 -3MBM 2.9 ISPF_BURP1
83 PsiBlast_CBE 81.4350%-142 - C8 -3MBM 3.2 ISPF_BURP1
89 PsiBlast_CBE 81.3250%-142 - C8 -3K2X 4.0 ISPF_BURP1
97 PsiBlast_CBE 81.0750%-145 - C8 -3IEW 3.8 ISPF_BURPS
75 PsiBlast_CBE 80.8350%-142 - C8 -3P10 3.2 ISPF_BURP1
121 PsiBlast_CBE 80.7650%-146 - C8 -3IKF 3.3 ISPF_BURPS
91 PsiBlast_CBE 80.1750%-147 - C8 -3K14 3.1 ISPF_BURP1
100 PsiBlast_CBE 80.0650%-142 - C8 -3IEQ 3.5 ISPF_BURP1
74 PsiBlast_CBE 79.9050%-149 - C8 -3Q8H 3.4 ISPF_BURPS
87 PsiBlast_CBE 79.8550%-146 - C8 -3K2X 3.3 ISPF_BURP1
88 PsiBlast_CBE 79.8450%-144 - C8 -3K2X 3.8 ISPF_BURP1
70 PsiBlast_CBE 79.6650%-141 - C8 -3QHD 3.6 ISPF_BURP1
85 PsiBlast_CBE 79.6050%-142 - C8 -3KE1 3.1 ISPF_BURP1
94 PsiBlast_CBE 79.5050%-137 - C8 -3JVH 3.1 ISPF_BURP1
81 PsiBlast_CBE 79.3750%-136 - C8 -3MBM 3.2 ISPF_BURP1
86 PsiBlast_CBE 79.2250%-147 - C8 -3KE1 3.2 ISPF_BURP1
90 PsiBlast_CBE 79.0850%-142 - C8 -3K14 2.7 ISPF_BURP1
96 PsiBlast_CBE 78.8850%-145 - C8 -3IEW 3.1 ISPF_BURPS
79 PsiBlast_CBE 78.8750%-145 - C8 -3P0Z 3.6 ISPF_BURP1
103 PsiBlast_CBE 78.7950%-145 - C8 -3F0G 3.2 ISPF_BURP1
99 PsiBlast_CBE 78.6050%-143 - C8 -3IEQ 3.2 ISPF_BURP1
120 PsiBlast_CBE 78.3850%-141 - C8 -3IKF 2.4 ISPF_BURPS
84 PsiBlast_CBE 78.3550%-144 - C8 -3KE1 2.8 ISPF_BURP1
102 PsiBlast_CBE 78.0250%-141 - C8 -3F0G 2.7 ISPF_BURP1
136 HHSearch 68.8946% -49 - C8 -3RE3 4.3 ISPF_FRATT
142 HHSearch 68.3639% -41 - C8 -4C81 3.3 ISPF_PLAF7