@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : I3TY27: (2017-12-13 )
MKNKTIILGGFTEMKKAKLFGLGAVALAAGLFLGACGNNGSTDSSGGKSSSDTTTAALITDTGGVDDRSFNQSAWEGLEKWGKDQGLSRGNDGFQYFQSSNESDYIPNIDQALNAGFKTIFGIGYKLKPAIQEQATNNTGTNFVIIDDVIDGLDNVVSATFKDNEASYLAGVAAAYTTETNVVGFIGGVKGEVIDRFDAGFKAGVDAGAKELGKEIKVLNQYAGDFSAPDKGRSIAQGMYAQNADIIFHASGGTGNGVFQEAKSLNESGDKKVWVIGVDRDQSDEGEYTLNGEKKNFTLTSTLKAVGTVVEDLAQKSADGKFPGGEHTVYGLKEDGVGLTEGQLSDEAKKAVDEAKEKIISGDVKVPETPEEN

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GMP_A_2(2FQX)
TMPC_TREPA
[Raw transfer]




GMP_A_2(2FQX)
TMPC_TREPA
[Raw transfer]




NOS_A_2(2FQW)
TMPC_TREPA
[Raw transfer]




ADN_A_2(2FQY)
TMPC_TREPA
[Raw transfer]




42 Fugue 89.2136% -2 - C3 -2FQX 7.1 TMPC_TREPA
1 PsiBlast_PDB 86.8336% -5 - C3 -2FQW 6.7 TMPC_TREPA
2 PsiBlast_PDB 86.2436% -2 - C3 -2FQX 7.1 TMPC_TREPA
3 PsiBlast_PDB 86.0136% -3 - C3 -2FQY 5.8 TMPC_TREPA
22 HHSearch 81.7436% 54 - C3 -2FQX - TMPC_TREPA -
21 HHSearch 77.9925% 21 - C3 -4PEV - ? -
4 PsiBlast_PDB 77.7123% 21 - C3 -4PEV - ? -
44 Fugue 76.0127% 24 - C3 -4PEV - ? -
45 Fugue 70.0021% -35 - C3 -3S99 - PBP_BRUA2 -
25 HHSearch 66.6223% 26 - C3 -2HQB - ? -
43 Fugue 64.6315% -0 - C3 -4IIL - TPN38_TREPA -
26 HHSearch 64.0317% 12 * C3 *4IIL - TPN38_TREPA -
24 HHSearch 62.1119% 27 - C3 -3S99 - PBP_BRUA2 -
13 PsiBlast_PDB 59.1325% 10 - C3 -4P98 - ? -
6 PsiBlast_PDB 55.8824% -76 - C3 -4YCS - ? -
5 PsiBlast_PDB 48.0522% 19 - C3 -3S99 - PBP_BRUA2 -
31 HHSearch 47.9013% 7 - C3 -5UFH - ? -
35 HHSearch 47.7713% 17 - C3 -2O20 - ? -
36 HHSearch 47.4015% 20 - C3 -2FEP - CCPA_BACSU -
34 HHSearch 47.2113% 13 - C3 -2O20 - ? -