@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo1363: (2016-03-23 )
LQDLTLFLEQYKKVIDESLFKEINERNIEPRLKESMLYSIQAGGKRIRPMLVFATLQALKVNPLLGVKTATALEMIHTYSLIHDDLPAMDNDDYRRGKWTNHKVFGDATAILAGDALLTLAFSILAEDDNLSFETRIALINQISFSSGAEGMVGGQLADLEAENKQVTLEELSSIHARKTGELLIYAVTSAAKIAEADPEQTKRLRIFAENIGIGFQISDDILDVIGDETKMGKKTGADAFLNKSTYPGLLTLDGAKRALNEHVTIAKSALSGHDFDDEILLKLADLIALREN

Atome Classification :

(54 SA) .........10......---..20--....---.--.-..30-----.--........40........50....--....------60.--...--....70........80........90........100.......110..--------.....120.......--130-.--.--....--.-.--140--.......150..--.....160..---..--..--.170.......180.......-190...-..--..-200..----.....210.......220.......230.......240.......250.....-.---.260.......270-.....---....280.......290.
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) LQDLTLFLEQYKKVIDE---SLFK--EINE---R--N-IEP------R--LKESMLYSIQAGGKRIRPMLVFAT--LQAL------KVN--PLL--GVKTATALEMIHTYSLIHDDLPAMDNDDYRRGKWTNHKVFGDATAILAG--------DALLTLAFSILAEDD--NL--S--F--ETRI--A-L--INQ--ISFSSGAEGMVG--GQLADLEAEN---KQ--VT--LEELSSIHARKTGELLIYAVT-SAAKIA-EA--DP-EQTKR----LRIFAENIGIGFQISDDILDVIGDETKMGKKTGADAFLNKSTYPGLLTLDGAK-R---ALNEHVTIAKSA---LSGHD---FDDEILLKLADLIALREN
1 PsiBlast_PDB 97.5852% -87 - C1 -1RTR - ? A:[8-291] ------------KLIDEVNNELSV--AINK---S--V-MDT------Q--LEESMLYSLNAGGKRIRPVLLLLT--LDSL------NTE--YEL--GMKSAIALEMIHTYSLIHDDLPAMDNDDYRRGKLTNHKVYGEWTAILAG--------DALLTKAFELISSDD--RL--T--D--EVKI--K-V--LQR--LSIASGHVGMVG--GQMLDMQSEG---QP--ID--LETLEMIHKTKTGALLTFAVM-SAADIA-NV--DD-TTKEH----LESYSYHLGMMFQIKDDLLDCYGDEA-------------KSTYVSLLGKDGAE-D---KLTYHRDAAVDE---LTQIDEQ-FNTKHLLEIVDLFYSR--
108 HHSearch 97.5351% -87 - C1 -1RTR - ? A:[7-291] --------NKLIDEVNN---ELSV--AINK---S--V-MDT------Q--LEESMLYSLNAGGKRIRPVLLLLT--LDSL------NTE--YEL--GMKSAIALEMIHTYSLIHDDLPAMDNDDYRRGKLTNHKVYGEWTAILAG--------DALLTKAFELISSDD--RL--T--D--EVKI--K-V--LQR--LSIASGHVGMVG--GQMLDMQSEG---QP--ID--LETLEMIHKTKTGALLTFAVM-SAADIA-NV--DD-TTKEH----LESYSYHLGMMFQIKDDLLDCYGDEA-------------KSTYVSLLGKDGAE-D---KLTYHRDAAVDE---LTQIDEQ-FNTKHLLEIVDLFYSR--
36 PsiBlast_CBE 95.1743% -80 - C1 -3TS7 ? B:[7-302] -RSLSDFMRSSQERVER---ALDA--RLPA---A--D-RMPE-----R--LHQAMRYSVLGGGKRMRPLLTYAT--GQTI------GVA--ADL--LDGPACAVEFIHVYSLIHDDLPAMDDDDLRRGKPTCHKAYDEATAILAG--------DGLQALAFHVLAQDP--SI--A--VPAENRI--A-M--IET--LAKASGPAGMVG--GQAIDLASVG---KK--LD--LPGLENMHIRKTGALIRASVR-LACLAR-PG--LPAEQFDR----LDHYAKCIGLAFQIQDDILDEESDTQTL-----------KPNYPALLGLSGAK-E---KAEEMHEAALES---LAGFG---PEADLLRELARFIIQRQS
16 PsiBlast_PDB 92.8143% -79 - C1 -3TS7 ? A:[7-302] -RSLSDFMRSSQERVER---ALDA--RLPA---A--D-RMPE-----R--LHQAMRYSVLGGGKRMRPLLTYAT--GQTI------GVA--ADL--LDGPACAVEFIHVYSLIHDDLPAMDDDDLRRGKPTCHKAYDEATAILAG--------DGLQALAFHVLAQDP--SI--A--VPAENRI--A-M--IET--LAKASGPAGMVG--GQAIDLASVG---KK--LD--LPGLENMHIRKTGALIRASVR-LACLAR-PG--LPAEQFDR----LDHYAKCIGLAFQIQDDILDEESD---------------KPNYPALLGLSGAK-E---KAEEMHEAALES---LAGFG---PEADLLRELARFIIQRQS
101 HHSearch 92.8044% -83 - C1 -3TS7 ? A:[8-301] --SLSDFMRSSQERVER---ALDA--RL-P---AADR-MPE------R--LHQAMRYSVLGGGKRMRPLLTYAT--GQTI------GVA--ADL--LDGPACAVEFIHVYSLIHDDLPAMDDDDLRRGKPTCHKAYDEATAILAG--------DGLQALAFHVLAQDP--SIAVP--A--ENRI--A-M--IET--LAKASGPAGMVG--GQAIDLASVG---KK--LD--LPGLENMHIRKTGALIRASVR-LACLARPGL--PA-EQFDR----LDHYAKCIGLAFQIQDDILDEESD---------------KPNYPALLGLSGAK-E---KAEEMHEAALES---LAGFG---PEADLLRELARFIIQRQ-
38 PsiBlast_CBE 90.4345% -70 - C1 -1RQJ ISPA_ECOLI B:[8-297] ----------------E---ACVK--QANQALSR--F-IAPLPFQNTP--VVETMQYGALLGGKRLRPFLVYAT--GHMF------GVS--TNT--LDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVKFGEANAILAG--------DALQTLAFSILSDADMPEV--S--D--RDRI--S-M--ISE--LASASGIAGMCG--GQALDLDAEG---KH--VP--LDALERIHRHKTGALIRAAVR-LGALSA-G------DKGRRALPVLDKYAESIGLAFQVQDDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQAR-K---KARDLIDDARQSLKQLAEQS---LDTSALEALADYIIQR--
21 PsiBlast_CBE 90.4145% -69 - C1 -4LFG ? B:[6-274] ------------KKIDQ---TIHA--FYCE---K--AVISE------K--LNEAVLYSINAGGKRIRPILFLEV--IEAL------QI---PLTESHFKAAAALEMIHTGSLIHDDLPAMDNDDYRRGQLTNHKKFDEATAILAG--------DSLFLDAFGMLAETD---F--P--T--DVTV--D-L--VRS--LSSASGTFGMVG--GQMLDMAAEG---KK--LN--LKNLQLIHRHKTGQLLAYPFW-AAARVA-QL--DE-NLLAT----FLEIGMIIGLAFQVRDDILDITANFEEIGKTPKKDVMAEKMTYPHLLGLNESY-Q---ILDESLDQAEA----------------ILRKLSDEIAF---
103 HHSearch 90.2141% -73 - C1 -3PDE ? A:[6-298] -ARLIAFEDQWVPALNA---PLKQ--AI-L---AD-S-QDA------Q--LAAAMTYSVLAGGKRLRPLLTVAT--MQSL------GVTFVPER--HWRPVMALELLHTYSLIHDDLPAMDNDALRRGEPTNHVKFGAGMATLAG--------DGLLTLAFQWLTATD--LP-----A--TMQA--A-L--VQA--LATAAGPSGMVA--GQAKDIQSEH---VN--LP--LSQLRVLHKEKTGALLHYAVQ-AGLILG-QA--PE-AQWPA----YLQFADAFGLAFQIYDDILDVVSS-----------ADEAKNTYPGKLGLIGAN-Q---ALIDTIHSGQAA---LQGLPTS-TQRDDLAAFFSYFDTE--
37 PsiBlast_CBE 90.1745% -72 - C1 -1RQI ISPA_ECOLI B:[9-298] ----------------E---ACVK--QANQALSR--F-IAPLPFQNTP--VVETMQYGALLGGKRLRPFLVYAT--GHMF------GVS--TNT--LDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVKFGEANAILAG--------DALQTLAFSILSDADMPEV--S--D--RDRI--S-M--ISE--LASASGIAGMCG--GQALDLDAEG---KH--VP--LDALERIHRHKTGALIRAAVR-LGALSA-G------DKGRRALPVLDKYAESIGLAFQVQDDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQAR-K---KARDLIDDARQSLKQLAEQS---LDTSALEALADYIIQR--
17 PsiBlast_PDB 89.9845% -71 - C1 -1RQI ISPA_ECOLI A:[9-298] ----------------E---ACVK--QANQALSR--F-IAPLPFQNTP--VVETMQYGALLGGKRLRPFLVYAT--GHMF------GVS--TNT--LDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVKFGEANAILAG--------DALQTLAFSILSDADMPEV--S--D--RDRI--S-M--ISE--LASASGIAGMCG--GQALDLDAEG---KH--VP--LDALERIHRHKTGALIRAAVR-LGALSA-G------DKGRRALPVLDKYAESIGLAFQVQDDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQAR-K---KARDLIDDARQSLKQLAEQS---LDTSALEALADYIIQR--
2 PsiBlast_PDB 89.8945% -84 - C1 -4LFE ? A:[6-274] ------------KKIDQ---TIHA--FYCE---K--AVISE------K--LNEAVLYSINAGGKRIRPILFLEV--IEAL------QI---PLTESHFKAAAALEMIHTGSLIHDDLPAMDNDDYRRGQLTNHKKFDEATAILAG--------DSLFLDAFGMLAETD---F--P--T--DVTV--D-L--VRS--LSSASGTFGMVG--GQMLDMAAEG---KK--LN--LKNLQLIHRHKTGQLLAYPFW-AAARVA-QL--DE-NLLAT----FLEIGMIIGLAFQVRDDILDITA----------------KMTYPHLLGLNESY-Q---ILDESLDQAEA----------------ILRKLSDEIAF---
104 HHSearch 89.8040% -80 - C1 -3LSN ? A:[2-293] --SLTAYQASSQARVDA---AMHT--LFTA---PS-P-ELA------R--LYEAMRYSVMNGGKRVRPLLAYAA--CEAL------GGK--PEQ--ANGAACAVELIHAYSLVHDDLPAMDDDDLRRGQPTTHKAFDEACAILAG--------DGLQSLAFSALLDPA--LSDAS--A--EIRL--R-M--VTT--LAQAAGPAGMVG--GQAIDLGSVG---LK--LD--QQALEYMHRHKTGALIEASVI-LGALAS-GR--AEKGELKA----LQTYAQAIGLAFQVQDDILDVESDTATL------------PTYPALLGLAAAK-E---YALELRDQALHA---LRPFD---AAAEPLRELARYIVE---
106 HHSearch 89.7545% -61 - C1 -1RQJ ISPA_ECOLI A:[2-299] --DFPQQLEACVKQANQ---ALSR--FIAPL--P--F-QNT------P--VVETMQYGALLGGKRLRPFLVYAT--GHMF------GVS--TNT--LDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVKFGEANAILAG--------DALQTLAFSILSDAD--MP--EVSD--RDRI--S-M--ISE--LASASGIAGMCG--GQALDLDAEG---KH--VP--LDALERIHRHKTGALIRAAVR-LGALSA-GD--KGRRALPV----LDKYAESIGLAFQVQDDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQAR-K---KARDLIDDARQS---LKQLAEQSLDTSALEALADYIIQRNK
18 PsiBlast_PDB 89.4545% -69 - C1 -1RQJ ISPA_ECOLI A:[8-297] ----------------E---ACVK--QANQALSR--F-IAPLPFQNTP--VVETMQYGALLGGKRLRPFLVYAT--GHMF------GVS--TNT--LDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVKFGEANAILAG--------DALQTLAFSILSDADMPEV--S--D--RDRI--S-M--ISE--LASASGIAGMCG--GQALDLDAEG---KH--VP--LDALERIHRHKTGALIRAAVR-LGALSA-G------DKGRRALPVLDKYAESIGLAFQVQDDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQAR-K---KARDLIDDARQSLKQLAEQS---LDTSALEALADYIIQR--
22 PsiBlast_CBE 89.3145% -69 - C1 -4LFE ? B:[6-274] ------------KKIDQ---TIHA--FYCE---K--AVISE------K--LNEAVLYSINAGGKRIRPILFLEV--IEAL------QI---PLTESHFKAAAALEMIHTGSLIHDDLPAMDNDDYRRGQLTNHKKFDEATAILAG--------DSLFLDAFGMLAETD---F--P--T--DVTV--D-L--VRS--LSSASGTFGMVG--GQMLDMAAEG---KK--LN--LKNLQLIHRHKTGQLLAYPFW-AAARVA-QL--DE-NLLAT----FLEIGMIIGLAFQVRDDILDITANFEEIGKTPKKDVMAEKMTYPHLLGLNESY-Q---ILDESLDQAEA----------------ILRKLSDEIAF---
28 PsiBlast_CBE 89.1440% -83 - C1 -4KKM ? B:[26-316] --NLKTMMEQVAQDIDR----LFA--EQLP---V--P-EDP------RRRLVEAMRYAAIGGGKRLRPLLVVAT--CALF------NVD--REA--ALRVGMAIECIHVYSLIHDDMPCMDNDDLRRGKPTVHKAFDDASAVLSG--------DALQALAFEILSEEKI-HT--D--P--HVRL--E-L--IQA--LAIASGKDGMVG--GQAIDLAAET---ST--VPFDLPTITRLQQLKTGALFGFCLE-AGAIMG-RQ--NK-DIRDR----LKAYARDIGLAFQIADDLIDAEGD--------------GKATFLSLLGLEKAR-S---QAQALVDQAIAH---LSVFG---SEADYLRSIARYIV----
8 PsiBlast_PDB 88.7240% -84 - C1 -4KKM - ? A:[26-317] --NLKTMMEQVAQDIDR----LFA--EQLP---V--P-EDP------RRRLVEAMRYAAIGGGKRLRPLLVVAT--CALF------NVD--REA--ALRVGMAIECIHVYSLIHDDMPCMDNDDLRRGKPTVHKAFDDASAVLSG--------DALQALAFEILSEEKI-HT--D--P--HVRL--E-L--IQA--LAIASGKDGMVG--GQAIDLAAET---ST--VPFDLPTITRLQQLKTGALFGFCLE-AGAIMG-RQ--NK-DIRDR----LKAYARDIGLAFQIADDLIDA-----------------GKATFLSLLGLEKAR-S---QAQALVDQAIAH---LSVFG---SEADYLRSIARYIVA---
26 PsiBlast_CBE 88.7043% -75 - C1 -3M9U ? C:[8-278] ---LIAFEDQWVPALNA---PLKQ--AILA---D--S-QDA------Q--LAAAMTYSVLAGGKRLRPLLTVAT--MQSL------GVTFVPER--HWRPVMALELLHTYSLIHDDLPAMDNDALRRGEPTNHVKFGAGMATLAG--------DGLLTLAFQWLTATD---L--P--A--TMQA--A-L--VQA--LATAAGPSGMVA--GQAKDIQSEH---VN--LP--LSQLRVLHKEKTGALLHYAVQ-AGLILG-QA--PE-AQWPA----YLQFADAFGLAFQIYDDILDVVSS--------------AKNTYPGKLGLIGAN-Q---ALIDTIHSGQAA---LQG-----------------------
3 PsiBlast_PDB 88.4845% -68 - C1 -4LFG ? A:[6-274] ------------KKIDQ---TIHA--FYCE---K--AVISE------K--LNEAVLYSINAGGKRIRPILFLEV--IEAL------QI---PLTESHFKAAAALEMIHTGSLIHDDLPAMDNDDYRRGQLTNHKKFDEATAILAG--------DSLFLDAFGMLAETD---F--P--T--DVTV--D-L--VRS--LSSASGTFGMVG--GQMLDMAAEG---KK--LN--LKNLQLIHRHKTGQLLAYPFW-AAARVA-QL--DE-NLLAT----FLEIGMIIGLAFQVRDDILDITANFEEIGKTPKKDVMAEKMTYPHLLGLNESY-Q---ILDESLDQAEA----------------ILRKLSDEIAF---
5 PsiBlast_PDB 88.0343% -71 - C1 -3M9U ? A:[8-278] ---LIAFEDQWVPALNA---PLKQ--AILA---D--S-QDA------Q--LAAAMTYSVLAGGKRLRPLLTVAT--MQSL------GVTFVPER--HWRPVMALELLHTYSLIHDDLPAMDNDALRRGEPTNHVKFGAGMATLAG--------DGLLTLAFQWLTATD---L--P--A--TMQA--A-L--VQA--LATAAGPSGMVA--GQAKDIQSEH---VN--LP--LSQLRVLHKEKTGALLHYAVQ-AGLILG-QA--PE-AQWPA----YLQFADAFGLAFQIYDDILDVVSS------------DEAKNTYPGKLGLIGAN-Q---ALIDTIHSGQAA---LQG-----------------------
111 HHSearch 87.4240% -79 - C1 -2J1P GGPPS_SINAL A:[13-292] ---PISYIIRKADSVNK---ALDS--AV-P---L--R-EPL------K--IHEAMRYSLLAGGKRVRPVLCIAA--CELV------GGE--ESL--AMPAACAVEMIHTMSLIHDDLPCMDNDDLRRGKPTNHKVYGEDVAVLAG--------DALLSFAFEHLASAT--SS--EVSP--ARVV--R-A--VGE--LAKAIGTEGLVA--GQVVDIS---LDLNN--VG--LEHLKFIHLHKTAALLEASAV-LGGIIG-GG--SD-EEIER----LRKFARCIGLLFQVVDDILDVTK----------------KLTYPKLMGLEKSR-E---FAEKLNTEARDQ---LLGFDS--DKVAPLLALANYIANRQ-
6 PsiBlast_PDB 87.3043% -70 - C1 -3PDE ? A:[8-278] ---LIAFEDQWVPALNA---PLKQ--AILA---D--S-QDA------Q--LAAAMTYSVLAGGKRLRPLLTVAT--MQSL------GVTFVPER--HWRPVMALELLHTYSLIHDDLPAMDNDALRRGEPTNHVKFGAGMATLAG--------DGLLTLAFQWLTATD---L--P--A--TMQA--A-L--VQA--LATAAGPSGMVA--GQAKDIQSEH---VN--LP--LSQLRVLHKEKTGALLHYAVQ-AGLILG-QA--PE-AQWPA----YLQFADAFGLAFQIYDDILDVVSS-----------ADEAKNTYPGKLGLIGAN-Q---ALIDTIHSGQAA---LQG-----------------------
23 PsiBlast_CBE 87.0943% -70 - C1 -3PDE ? D:[8-278] ---LIAFEDQWVPALNA---PLKQ--AILA---D--S-QDA------Q--LAAAMTYSVLAGGKRLRPLLTVAT--MQSL------GVTFVPER--HWRPVMALELLHTYSLIHDDLPAMDNDALRRGEPTNHVKFGAGMATLAG--------DGLLTLAFQWLTATD---L--P--A--TMQA--A-L--VQA--LATAAGPSGMVA--GQAKDIQSEH---VN--LP--LSQLRVLHKEKTGALLHYAVQ-AGLILG-QA--PE-AQWPA----YLQFADAFGLAFQIYDDILDVVSSPA---------ADEAKNTYPGKLGLIGAN-Q---ALIDTIHSGQAA---LQG-----------------------
24 PsiBlast_CBE 86.9643% -71 - C1 -3PDE ? C:[8-278] ---LIAFEDQWVPALNA---PLKQ--AILA---D--S-QDA------Q--LAAAMTYSVLAGGKRLRPLLTVAT--MQSL------GVTFVPER--HWRPVMALELLHTYSLIHDDLPAMDNDALRRGEPTNHVKFGAGMATLAG--------DGLLTLAFQWLTATD---L--P--A--TMQA--A-L--VQA--LATAAGPSGMVA--GQAKDIQSEH---VN--LP--LSQLRVLHKEKTGALLHYAVQ-AGLILG-QA--PE-AQWPA----YLQFADAFGLAFQIYDDILDVVS----------------KNTYPGKLGLIGAN-Q---ALIDTIHSGQAA---LQG-----------------------
25 PsiBlast_CBE 86.1843% -70 - C1 -3PDE ? B:[8-278] ---LIAFEDQWVPALNA---PLKQ--AILA---D--S-QDA------Q--LAAAMTYSVLAGGKRLRPLLTVAT--MQSL------GVTFVPER--HWRPVMALELLHTYSLIHDDLPAMDNDALRRGEPTNHVKFGAGMATLAG--------DGLLTLAFQWLTATD---L--P--A--TMQA--A-L--VQA--LATAAGPSGMVA--GQAKDIQSEH---VN--LP--LSQLRVLHKEKTGALLHYAVQ-AGLILG-QA--PE-AQWPA----YLQFADAFGLAFQIYDDILDVVS-----------DADEAKNTYPGKLGLIGAN-Q---ALIDTIHSGQAA---LQG-----------------------
27 PsiBlast_CBE 86.0443% -71 - C1 -3M9U ? B:[8-278] ---LIAFEDQWVPALNA---PLKQ--AILA---D--S-QDA------Q--LAAAMTYSVLAGGKRLRPLLTVAT--MQSL------GVTFVPER--HWRPVMALELLHTYSLIHDDLPAMDNDALRRGEPTNHVKFGAGMATLAG--------DGLLTLAFQWLTATD---L--P--A--TMQA--A-L--VQA--LATAAGPSGMVA--GQAKDIQSEH---VN--LP--LSQLRVLHKEKTGALLHYAVQ-AGLILG-QA--PE-AQWPA----YLQFADAFGLAFQIYDDILDVVS-------------DEAKNTYPGKLGLIGAN-Q---ALIDTIHSGQAA---LQG-----------------------
45 PsiBlast_CBE 84.6542% -86 - C1 -3ZMB ? B:[31-292] -----------------------------------------------R--LYEAMRYSVMNGGKRVRPLLAYAA--CEAL------GGA--PQR--ADAAACAVELIHAYSLVHDDLPAMDDDDLRRGQPTTHRAFDEATAILAA--------DGLQALAFEVLADTR--RN--P--Q--EHAV--C-LEMLTR--LARAAGSAGMVG--GQAIDLGSVG---VA--LD--QAALEVMHRHKTGALIEASVRLGALASG-RA--EP-ASLAA----LERYAEAIGLAFQVQDDILDVE------------------PTYPALLGLEAAK-G---YALELRDLALAA---LDGFP---PSADPLRQLARYIV----
46 PsiBlast_CBE 84.4242% -84 - C1 -3ZMB ? A:[31-295] -----------------------------------------------R--LYEAMRYSVMNGGKRVRPLLAYAA--CEAL------GGA--PQR--ADAAACAVELIHAYSLVHDDLPAMDDDDLRRGQPTTHRAFDEATAILAA--------DGLQALAFEVLADTR--RN--P--Q--EHAV--C-LEMLTR--LARAAGSAG