@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu30420: (2016-07-20 )
MIDVQHIDHSFTIGKKGRENEVPVLKDVSLSVAKGEIACIVGRSGSGKSTLLNLISGYISPTKGRIVINGTDVTGFNEKEWAQFRLDHFGFIFQSFQLIPGLTTYENVEMPLALKGIKPSERKQKVQDMLKRVGLENHAAHYPNELSGGQQQRVSIARALILNPSIILADEPTGSLDSETEHEVLELIQQLNRERGITFVIITHDDEVASIGHSKFQLHDGVLKGGITVEV

Atome Classification :

(53 SA) -.........10........20........30........40........50........60........70........80.-------....--...90.--..--.....100......--------.110..---..---....120.--......130......-.-140...-----------.....150.......160.......170.......180.......190.......200---.....-.-...-210--........220..-.....230--------------------------------------------------------------------------------------------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -MIDVQHIDHSFTIGKKGRENEVPVLKDVSLSVAKGEIACIVGRSGSGKSTLLNLISGYISPTKGRIVINGTDVTGFNEKEWA-------QFRL--DHFGFI--FQ--SFQLIPGLTTYENV--------EM-PLA---LK---GIKPSERK--QKVQDMLKRVGLENH-A-A-HYPN-----------ELSGGQQQRVSIARALILNPSIILADEPTGSLDSETEHEVLELIQQLNRERGITFV-----IITHD-D-EVA-S-I--GHSKFQLHDGVLK-GGITVEV---------------------------------------------------------------------------------------------------------------
1 PsiBlast_PDB 85.6344% -27 - C1 -1L2T Y796_METJA A:[1-221] -MIKLKNVTKTYKMG----EEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDLDDDELT-------KIRR--DKIGFV--FQ--QFNLIPLLTALENV--------EL-PLI---FKYRGAMSGEERR--KRALECLKMAELEERFA-N-HKPN-----------QLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEDGKTVV-----VVTHD-I-NVA-R-F--GERIIYLKDG--------------------------------------------------------------------------------------------------------------------------
21 PsiBlast_CBE 84.2044% -30 - C1 -1L2T Y796_METJA B:[1-221] -MIKLKNVTKTYKMG----EEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDLDDDELT-------KIRR--DKIGFV--FQ--QFNLIPLLTALENV--------EL-PLI---FKYRGAMSGEERR--KRALECLKMAELEERFA-N-HKPN-----------QLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEDGKTVV-----VVTHD-I-NVA-R-F--GERIIYLKDG--------------------------------------------------------------------------------------------------------------------------
122 HHSearch 82.9438%-132 - C1 -3TUI METN_ECOLI C:[24-248] -MIKLSNITKVFHQGTR----TIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESELT-------KA-R--RQIGMI--FQ--HFNLLSSRTVFGNV--------AL-PLE---LD---NTPKDEVK--RRVTELLSLVGLGDK-H-D-SYPS-----------NLSGGQKQRVAIARALASNPKVLLCDQATSALDPATTRSILELLKDINRRLGLTIL-----LITHE-M-DVV-KRI--CDCVAVISNGELI-EQDTV-----------------------------------------------------------------------------------------------------------------
22 PsiBlast_CBE 82.7343% -29 - C1 -3TIF Y796_METJA B:[1-221] -MVKLKNVTKTYKMG----EEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDLDDDELT-------KIRR--DKIGFV--FQ--QFNLIPLLTALENV--------EL-PLI---FKYRGAMSGEERR--KRALECLKMAELEERFA-N-HKPN-----------QLSGGQQQRVAIARALANNPPIILADQPTWALDSKTGEKIMQLLKKLNEEDGKTVV-----VVTHD-I-NVA-R-F--GERIIYLKDG--------------------------------------------------------------------------------------------------------------------------
3 PsiBlast_PDB 82.0244% -25 * C1 *1F3O Y796_METJA A:[2-221] --IKLKNVTKTYKMG----EEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDLDDDELT-------KIRR--DKIGFV--FQ--QFNLIPLLTALENV--------EL-PLI---FKYRGAMSGEERR--KRALECLKMAELEERFA-N-HKPN-----------QLSGGQQQRVAIARALANNPPIILADEPTGALDSKTGEKIMQLLKKLNEEDGKTVV-----VVTHD-I-NVA-R-F--GERIIYLKDG--------------------------------------------------------------------------------------------------------------------------
2 PsiBlast_PDB 81.1843% -30 - C1 -3TIF Y796_METJA A:[1-221] -MVKLKNVTKTYKMG----EEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDLDDDELT-------KIRR--DKIGFV--FQ--QFNLIPLLTALENV--------EL-PLI---FKYRGAMSGEERR--KRALECLKMAELEERFA-N-HKPN-----------QLSGGQQQRVAIARALANNPPIILADQPTWALDSKTGEKIMQLLKKLNEEDGKTVV-----VVTHD-I-NVA-R-F--GERIIYLKDG--------------------------------------------------------------------------------------------------------------------------
8 PsiBlast_PDB 78.7038%-149 - C1 -3TUZ METN_ECOLI C:[24-226] -MIKLSNITKVFHQGTR----TIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESELT-------KAR---RQIGMI--FQ--HFNLLSSRTVFGNV--------AL-PLE---LD---NTPKDEVK--RRVTELLSLVGLGDK-H-D-SYPS-----------NLSGGQKQRVAIARALASNPKVLLCDQATSALDPATTRSILELLKDINRRLGLTIL-----LITHE-M-DV-------------------------------------------------------------------------------------------------------------------------------------------
4 PsiBlast_PDB 78.1843%-115 - C1 -2PCJ - LOLD_AQUAE A:[19-222] ------------------------ILKGISLSVKKGEFVSIIGASGSGKSTLLYILGLLDAPTEGKVFLEGKEVDYTNEKELS-------LLRN--RKLGFV--FQ--FHYLIPELTALENV--------IV-PML---KM---GKPKKEAK--ERGEYLLSELGLGDK-L-S-RKPY-----------ELSGGEQQRVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKIN-EGGTSIV-----MVTHE-R-ELA-E-L--THRTLEMKDGKVV-GEIT------------------------------------------------------------------------------------------------------------------
5 PsiBlast_PDB 77.1143%-114 - C1 -2PCL LOLD_AQUAE A:[19-222] ------------------------ILKGISLSVKKGEFVSIIGASGSGKSTLLYILGLLDAPTEGKVFLEGKEVDYTNEKELS-------LLRN--RKLGFV--FQ--FHYLIPELTALENV--------IV-PML---KM---GKPKKEAK--ERGEYLLSELGLGDK-L-S-RKPY-----------ELSGGEQQRVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKIN-EGGTSIV-----MVTHE-R-ELA-E-L--THRTLEMKDGKVV-GEIT------------------------------------------------------------------------------------------------------------------
28 PsiBlast_CBE 75.2538%-139 - C1 -3TUI METN_ECOLI G:[24-226] -MIKLSNITKVFHQGTR----TIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESELT-------KAR---RQIGMI--FQ--HFNLLSSRTVFGNV--------AL-PLE---LD---NTPKDEVK--RRVTELLSLVGLGDK-H-D-SYPS-----------NLSGGQKQRVAIARALASNPKVLLCDQATSALDPATTRSILELLKDINRRLGLTIL-----LITHE-M-DV-------------------------------------------------------------------------------------------------------------------------------------------
104 Fugue 74.5638% -20 - C1 -3TUZ METN_ECOLI H:[23-362] HMIKLSNITKVFHQGT----RTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESELT-------KARR--Q-IGMI--FQ--HFNLLSSRTVFGNV--------AL-PLE---LD---NTPKDEVK--RRVTELLSLVGLGDK-H-D-SYPS-----------NLSGGQKQRVAIARALASNPKVLLCDQATSALDPATTRSILELLKDINRRLGLTIL-----LITHEMD-VVK-R-I--CDCVAVISNGELIEQDTVSEVFSHPKTPLAQKFIQSTLHLDIPEDYQERLQAEPFTDCVPMLRLEFTGQSVDAPLLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQQDTQAAIAWLQEHHVKVEV
7 PsiBlast_PDB 74.3338%-140 - C1 -3TUI METN_ECOLI C:[24-226] -MIKLSNITKVFHQGTR----TIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESELT-------KAR---RQIGMI--FQ--HFNLLSSRTVFGNV--------AL-PLE---LD---NTPKDEVK--RRVTELLSLVGLGDK-H-D-SYPS-----------NLSGGQKQRVAIARALASNPKVLLCDQATSALDPATTRSILELLKDINRRLGLTIL-----LITHE-M-DV-------------------------------------------------------------------------------------------------------------------------------------------
27 PsiBlast_CBE 74.2638%-147 - C1 -3TUI METN_ECOLI H:[24-226] -MIKLSNITKVFHQGTR----TIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESELT-------KAR---RQIGMI--FQ--HFNLLSSRTVFGNV--------AL-PLE---LD---NTPKDEVK--RRVTELLSLVGLGDK-H-D-SYPS-----------NLSGGQKQRVAIARALASNPKVLLCDQATSALDPATTRSILELLKDINRRLGLTIL-----LITHE-M-DV-------------------------------------------------------------------------------------------------------------------------------------------
24 PsiBlast_CBE 73.7138%-147 - C1 -3TUZ METN_ECOLI H:[24-226] -MIKLSNITKVFHQGTR----TIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESELT-------KAR---RQIGMI--FQ--HFNLLSSRTVFGNV--------AL-PLE---LD---NTPKDEVK--RRVTELLSLVGLGDK-H-D-SYPS-----------NLSGGQKQRVAIARALASNPKVLLCDQATSALDPATTRSILELLKDINRRLGLTIL-----LITHE-M-DV-------------------------------------------------------------------------------------------------------------------------------------------
25 PsiBlast_CBE 72.8038%-141 - C1 -3TUZ METN_ECOLI G:[24-226] -MIKLSNITKVFHQGTR----TIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESELT-------KAR---RQIGMI--FQ--HFNLLSSRTVFGNV--------AL-PLE---LD---NTPKDEVK--RRVTELLSLVGLGDK-H-D-SYPS-----------NLSGGQKQRVAIARALASNPKVLLCDQATSALDPATTRSILELLKDINRRLGLTIL-----LITHE-M-DV-------------------------------------------------------------------------------------------------------------------------------------------
29 PsiBlast_CBE 72.2638%-135 - C1 -3TUI METN_ECOLI D:[24-226] -MIKLSNITKVFHQGTR----TIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESELT-------KAR---RQIGMI--FQ--HFNLLSSRTVFGNV--------AL-PLE---LD---NTPKDEVK--RRVTELLSLVGLGDK-H-D-SYPS-----------NLSGGQKQRVAIARALASNPKVLLCDQATSALDPATTRSILELLKDINRRLGLTIL-----LITHE-M-DV-------------------------------------------------------------------------------------------------------------------------------------------
6 PsiBlast_PDB 70.5739%-139 - C1 -3DHW - METN_ECOLI C:[1-203] -MIKLSNITKVFHQGTR----TIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESELT-------KAR---RQIGMI--FQ--HFNLLSSRTVFGNV--------AL-PLE---LD---NTPKDEVK--RRVTELLSLVGLGDK-H-D-SYPS-----------NLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRRLGLTIL-----LITHE-M-DV-------------------------------------------------------------------------------------------------------------------------------------------
13 PsiBlast_PDB 69.2242% -73 - C1 -4YMV ? J:[16-214] ------------------------VLKGVTLKVNKGEVVVIIGPSGSGKSTLLRCINLLEEPTKGEVFIDGVKIN--NGKVNI-------NKVR--QKVGMV--FQ--HFNLFPHLTAIENI--------TLAPVK---VK---KMNKKEAE--ELAVDLLAKVGLLDK-K-D-QYPI-----------KLSGGQKQRLAIARALAMQPEVMLFDEPTSALDPEMVKEVLNVMKQLANE-GMTMV-----VVTHE-M-GFARE-V--GDRVIFMDDGVI------------------------------------------------------------------------------------------------------------------------
118 HHSearch 68.8136%-108 - C1 -2IT1 - ? A:[4-219] --IKLENIVKKFGN--------FTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTELPP------------K-D--RNVGLV--FQ--NWALYPHMTVYKNI--------AF-PLE---LR---KAPREEID--KKVREVAKMLHIDKL-L-N-RYPW-----------QLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELGITTV-----YVTHD-Q-AEA-LAM--ADRIAVIREGEIL-QVGTPD----------------------------------------------------------------------------------------------------------------
26 PsiBlast_CBE 68.6938%-136 - C1 -3TUZ METN_ECOLI D:[24-226] -MIKLSNITKVFHQGTR----TIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESELT-------KAR---RQIGMI--FQ--HFNLLSSRTVFGNV--------AL-PLE---LD---NTPKDEVK--RRVTELLSLVGLGDK-H-D-SYPS-----------NLSGGQKQRVAIARALASNPKVLLCDQATSALDPATTRSILELLKDINRRLGLTIL-----LITHE-M-DV-------------------------------------------------------------------------------------------------------------------------------------------
31 PsiBlast_CBE 68.2642% -72 - C1 -4YMU ? A:[16-214] ------------------------VLKGVTLKVNKGEVVVIIGPSGSGKSTLLRCINLLEEPTKGEVFIDGVKIN--NGKVNI-------NKVR--QKVGMV--FQ--HFNLFPHLTAIENI--------TLAPVK---VK---KMNKKEAE--ELAVDLLAKVGLLDK-K-D-QYPI-----------KLSGGQKQRLAIARALAMQPEVMLFDEPTSALDPEMVKEVLNVMKQLANE-GMTMV-----VVTHE-M-GFARE-V--GDRVIFMDDGVI------------------------------------------------------------------------------------------------------------------------
30 PsiBlast_CBE 67.7042% -72 - C1 -4YMV ? A:[16-214] ------------------------VLKGVTLKVNKGEVVVIIGPSGSGKSTLLRCINLLEEPTKGEVFIDGVKIN--NGKVNI-------NKVR--QKVGMV--FQ--HFNLFPHLTAIENI--------TLAPVK---VK---KMNKKEAE--ELAVDLLAKVGLLDK-K-D-QYPI-----------KLSGGQKQRLAIARALAMQPEVMLFDEPTSALDPEMVKEVLNVMKQLANE-GMTMV-----VVTHE-M-GFARE-V--GDRVIFMDDGVI------------------------------------------------------------------------------------------------------------------------
12 PsiBlast_PDB 67.5342% -70 - C1 -4YMU ? J:[16-214] ------------------------VLKGVTLKVNKGEVVVIIGPSGSGKSTLLRCINLLEEPTKGEVFIDGVKIN--NGKVNI-------NKVR--QKVGMV--FQ--HFNLFPHLTAIENI--------TLAPVK---VK---KMNKKEAE--ELAVDLLAKVGLLDK-K-D-QYPI-----------KLSGGQKQRLAIARALAMQPEVMLFDEPTSALDPEMVKEVLNVMKQLANE-GMTMV-----VVTHE-M-GFARE-V--GDRVIFMDDGVI------------------------------------------------------------------------------------------------------------------------
63 PsiBlast_CBE 62.6841% -16 - C1 -1B0U HISP_SALTY A:[21-212] ------------------------VLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINLVRDKDGQLKVADKNQLRLLRTRLTMV--FQ--HFNLWSHMTVLENVM-------EA-PIQ---VL---GLSKHDAR--ERALKYLAKVGIDER-AQG-KYPV-----------HLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLA-EEGKTMV-----VVTHE------------------------------------------------------------------------------------------------------------------------------------------------
121 HHSearch 62.4534%-116 - C1 -3FVQ FBPC_NEIG1 A:[4-229] -ALHIGHLSKSFQN--------TPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIFSKNTN-L--------PVRE--RRLGYL--VQ--EGVLFPHLTVYRNI--------AY-GLG---NG---KGRTAQER--QRIEAMLELTGISEL-A-G-RYPH-----------ELSGGQQQRAALARALAPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKSAV-----FVSHD-R-EEA-LQY--ADRIAVMKQGRIL-QTASPH----------------------------------------------------------------------------------------------------------------
64 PsiBlast_CBE 61.1635%-129 - C1 -3FVQ FBPC_NEIG1 B:[5-202] --LHIGHLSKSF--------QNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTI--FSKNTNL-------PVRE--RRLGYL--VQ--EGVLFPHLTVYRNI--------AY-GLG---NG---KGRTAQER--QRIEAMLELTGISEL-A-G-RYPH-----------ELSGGQQQRAALARALAPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKSAV-----FVSHD-R-EEA------------------------------------------------------------------------------------------------------------------------------------------
65 PsiBlast_CBE 60.8235%-130 - C1 -3FVQ FBPC_NEIG1 A:[5-207] --LHIGHLSKSF--------QNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTI--FSKNTNL-------PVRE--RRLGYL--VQ--EGVLFPHLTVYRNI--------AY-GLG---NG---KGRTAQER--QRIEAMLELTGISEL-A-G-RYPH-----------ELSGGQQQRAALARALAPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKSAV-----FVSHD-R-EEA------------------------------------------------------------------------------------------------------------------------------------------
46 PsiBlast_CBE 60.7236% -84 - C1 -2OLK ? D:[24-218] -MIDVHQLKKSF--------GSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINLKA-KDTNLN-------KVR---EEVGMV--FQ--RFNLFPHMTVLNNI--------TLAPMK---VR---KWPREKAE--AKAMELLDKVGLKDK-A-H-AYPD-----------SLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANE-GMTMV-----VVTHE------------------------------------------------------------------------------------------------------------------------------------------------
49 PsiBlast_CBE 59.9136% -81 - C1 -2OLK ? A:[24-218] -MIDVHQLKKSF--------GSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINLKA-KDTNLN-------KVR---EEVGMV--FQ--RFNLFPHMTVLNNI--------TLAPMK---VR---KWPREKAE--AKAMELLDKVGLKDK-A-H-AYPD-----------SLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANE-GMTMV-----VVTHE------------------------------------------------------------------------------------------------------------------------------------------------
48 PsiBlast_CBE 59.3136% -87 - C1 -2OLK ? B:[24-218] -MIDVHQLKKSF--------GSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINLKA-KDTNLN-------KVR---EEVGMV--FQ--RFNLFPHMTVLNNI--------TLAPMK---VR---KWPREKAE--AKAMELLDKVGLKDK-A-H-AYPD-----------SLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANE-GMTMV-----VVTHE------------------------------------------------------------------------------------------------------------------------------------------------
41 PsiBlast_CBE 59.1836% -76 - C1 -2Q0H ? A:[24-218] -MIDVHQLKKSF--------GSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINLKA-KDTNLN-------KVR---EEVGMV--FQ--RFNLFPHMTVLNNI--------TLAPMK---VR---KWPREKAE--AKAMELLDKVGLKDK-A-H-AYPD-----------SLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANE-GMTMV-----VVTHE------------------------------------------------------------------------------------------------------------------------------------------------
38 PsiBlast_CBE 58.9236% -76 - C1 -3C4J ? B:[24-218] -MIDVHQLKKSF--------GSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINLKA-KDTNLN-------KVR---EEVGMV--FQ--RFNLFPHMTVLNNI--------TLAPMK---VR---KWPREKAE--AKAMELLDKVGLKDK-A-H-AYPD-----------SLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANE-GMTMV-----VVTHE------------------------------------------------------------------------------------------------------------------------------------------------
19 PsiBlast_PDB 58.4336% -75 - C1 -3C41 ? J:[3-197] -MIDVHQLKKSF--------GSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINLKA-KDTNLN-------KVR---EEVGMV--FQ--RFNLFPHMTVLNNI--------TLAPMK---VR---KWPREKAE--AKAMELLDKVGLKDK-A-H-AYPD-----------SLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANE-GMTMV-----VVTHE------------------------------------------------------------------------------------------------------------------------------------------------
20 PsiBlast_PDB 58.2836% -85 - C1 -2OLJ ? A:[24-218] -MIDVHQLKKSF--------GSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINLKA-KDTNLN-------KVR---EEVGMV--FQ--RFNLFPHMTVLNNI--------TLAPMK---VR---KWPREKAE--AKAMELLDKVGLKDK-A-H-AYPD-----------SLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANE-GMTMV-----VVTHE------------------------------------------------------------------------------------------------------------------------------------------------
17 PsiBlast_PDB 57.6841% -60 - C1 -4U00 ? A:[19-197] ------------------------VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLSVK--DDRALR-------EIRR--E-VGMV--FQ--QFNLFPHMTVLENV--------TLAPMR---VR---RWPREKAE--KKALELLERVGILDQ-A-R-KYPA-----------QLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLA-QGGMTMV-----VVTHE------------------------------------------------------------------------------------------------------------------------------------------------
37 PsiBlast_CBE 57.0836% -79 - C1 -3C41 ? K:[3-197] -MIDVHQLKKSF--------GSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINLKA-KDTNLN-------KVR---EEVGMV--FQ--RFNLFPHMTVLNNI--------TLAPMK---VR---KWPREKAE--AKAMELLDKVGLKDK-A-H-AYPD-----------SLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANE-GMTMV-----VVTHE------------------------------------------------------------------------------------------------------------------------------------------------
47 PsiBlast_CBE 56.8136% -85 - C1 -2OLK ? C:[24-218] -MIDVHQLKKSF--------GSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINLKA-KDTNLN-------KVR---EEVGMV--FQ--RFNLFPHMTVLNNI--------TLAPMK---VR---KWPREKAE--AKAMELLDKVGLKDK-A-H-AYPD-----------SLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANE-GMTMV-----VVTHE------------------------------------------------------------------------------------------------------------------------------------------------
40 PsiBlast_CBE 56.1336% -81 - C1 -2Q0H ? B:[24-218] -MIDVHQLKKSF--------GSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINLKA-KDTNLN-------KVR---EEVGMV--FQ--RFNLFPHMTVLNNI--------TLAPMK---VR---KWPREKAE--AKAMELLDKVGLKDK-A-H-AYPD-----------SLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANE-GMTMV-----VVTHE------------------------------------------------------------------------------------------------------------------------------------------------
39 PsiBlast_CBE 55.4836% -79 - C1 -3C4J ? A:[24-218] -MIDVHQLKKSF--------GSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINLKA-KDTNLN-------KVR---EEVGMV--FQ--RFNLFPHMTVLNNI--------TLAPMK---VR---KWPREKAE--AKAMELLDKVGLKDK-A-H-AYPD-----------SLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANE-GMTMV-----VVTHE------------------------------------------------------------------------------------------------------------------------------------------------
50 PsiBlast_CBE 52.4736% -79 - C1 -2OLJ ? B:[24-218] -MIDVHQLKKSF--------GSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINLKA-KDTNLN-------KVR---EEVGMV--FQ--RFNLFPHMTVLNNI--------TLAPMK---VR---KWPREKAE--AKAMELLDKVGLKDK-A-H-AYPD-----------SLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANE-GMTMV-----VVTHE------------------------------------------------------------------------------------------------------------------------------------------------
60 PsiBlast_CBE 52.0633%-137 - C1 -1VCI ? A:[31-216] ----------------------------LNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPPKD---------------RNISMV--FQ--------HMTVYENI--------AF-PL-----K---KFPKDEID--KRVRWAAELLQIEEL-L-N-RYPA-----------QLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTI-----YVTHD-QVEAM-T-M--G-----------------------------------------------------------------------------------------------------------------------------------
99 PsiBlast_CBE 47.4935% -11 - C1 -1G9X LIVG_METJA B:[19-211] ---------------------EFKALDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITN---KEPA-------E--L--YHYGIVRTFQ--TPQPLKEMTVLENLLIGEINPGES-PLNSLFYK---KWIPKEEEMVEKAFKILEFLKLSHL-Y-D-RKAG-----------ELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLEL-KAKGITFL-----IIEH-------------------------------------------------------------------------------------------------------------------------------------------------
101 PsiBlast_CBE 47.4635% -5 - C1 -1G6H LIVG_METJA A:[19-211] ---------------------EFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITN---KEPA-------E--L--YHYGIVRTFQ--TPQPLKEMTVLENLLIGEICPGES-PLNSLFYK---KWIPKEEEMVEKAFKILEFLKLSHL-Y-D-RKAG-----------ELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLEL-KAKGITFL-----IIEH-------------------------------------------------------------------------------------------------------------------------------------------------
97 PsiBlast_CBE 44.9332% -67 - C1 -2HYD Y1866_STAAM A:[340-552] --IDIDHVSFQYN------DNEAPILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLTGSLR-------------NQIGLV--QQ--DNILFSD-TVKENI--------LL-G------------RPTATD--EEVVEAAKMANAHDF-I-M-NLPQGYDTEVGERGVKLSGGQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLSTITHA-D-KIV-V-IENGH----------------------------------------------------------------------------------------------------------------------------------
95 PsiBlast_CBE 44.9032% -67 - C1 -2ONJ Y1866_STAAM A:[340-552] --IDIDHVSFQYN------DN