@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0742: (2016-03-18 )
MLVGNNIAKSYPNKLVLQNVDFEAKSGDMIVLTGENGSGKTTLLDMLASLKKPDSGTLELDNELFTTNDIRQQIAYLNNELYAKKSTTIEDFMKQHGLLFENIELDKWDRLLAGWRINKRLKLGELSTGMLMKVKIGSVLARKAKLYLYDEPFASIDIMARSEVMKAIISETNPDAITIISSHHLEGTEKLYSKLWLIKDNTLQTIETETYREETGNALIDFYKEEMNK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_3(3FVQ)
FBPC_NEIG1
[Raw transfer]




2 PsiBlast_PDB 88.0927% -80 - C1 -1VPL - ? -
9 PsiBlast_PDB 87.8626% -80 - C1 -4P32 - LPTB_ECOLI -
8 PsiBlast_PDB 87.3326% -76 - C1 -4QC2 - ? -
48 HHSearch 85.2623% -87 - C1 -1VPL - ? -
10 PsiBlast_PDB 84.5525% -73 - C1 -4P33 - LPTB_ECOLI -
29 HHSearch 83.4322% -83 - C1 -1Z47 - ? -
7 PsiBlast_PDB 81.0326% -75 - C1 -2IHY - ? -
4 PsiBlast_PDB 80.7725% -84 - C1 -4RVC - ? -
3 PsiBlast_PDB 80.5725% -88 - C1 -4WBS - ? -
6 PsiBlast_PDB 80.1721% -56 - C1 -1Z47 - ? -
38 HHSearch 80.0420% -86 - C1 -3TUI - METN_ECOLI -
53 Fugue 79.8323% -60 - C1 -1Z47 - ? -
32 HHSearch 78.7022% -87 - C1 -3FVQ 6.8 FBPC_NEIG1
44 HHSearch 78.5722% -86 - C1 -3GFO - ECFA3_CLOP1 -
23 PsiBlast_CBE 76.8331% -88 - C1 -2PJZ - ? -
13 PsiBlast_PDB 76.1826% -80 - C1 -4MKI - ECFA2_CALS4 -
35 HHSearch 74.6920% -81 - C1 -2YYZ - ? -
46 HHSearch 74.5720% -89 * C1 *2OLJ - ? -
47 HHSearch 73.8420% -96 - C1 -1B0U - HISP_SALTY -
45 HHSearch 73.3417% -94 - C1 -3GD7 - CFTR_HUMAN (first) -