@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00186_DYR_ST: (2014-08-31 )
MTLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSFNVVGVDVIHSIEDIYQLPGHVFIFGGQILFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK

Atome Classification :

(50 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

N22_A_3(3FQ0)
?
[Raw transfer]




I2H_X_3(3FYW)
DYR_STAAU
[Raw transfer]




5DR_A_5(3SH2)
DYR_STAAU
[Raw transfer]




TOP_X_3(3FRE)
DYR_STAAU
[Raw transfer]




Q27_X_2(3SRW)
DYR_STAAU
[Raw transfer]




XCF_X_3(3FRF)
DYR_STAAU
[Raw transfer]




N22_A_3(3FQO)
?
[Raw transfer]




N22_X_2(3I8A)
DYR_STAAU
[Raw transfer]




I2H_X_3(3FRA)
DYR_STAAU
[Raw transfer]




M23_X_2(3SRS)
DYR_STAAU
[Raw transfer]




Q26_X_3(3SRU)
DYR_STAAU
[Raw transfer]




53T_X_3(3F0S)
?
[Raw transfer]




53T_X_3(3F0X)
?
[Raw transfer]




TOP_X_3(3FRB)
DYR_STAAU
[Raw transfer]




TOP_F_21(2W9S)
DYRA_STAAU
[Raw transfer]




TOP_B_12(2W9S)
DYRA_STAAU
[Raw transfer]




XCF_X_3(3FYV)
DYR_STAAU
[Raw transfer]




11F_A_3(3FQV)
?
[Raw transfer]




TOP_C_15(2W9S)
DYRA_STAAU
[Raw transfer]




TOP_A_9(2W9S)
DYRA_STAAU
[Raw transfer]




5DR_B_6(3SH2)
DYR_STAAU
[Raw transfer]




11F_A_2(3FQZ)
?
[Raw transfer]




1VM_X_3(4LAE)
?
[Raw transfer]




Q11_X_3(3SQY)
DYR_STAAU
[Raw transfer]




55V_A_2(3FQF)
?
[Raw transfer]




1DN_X_3(4LEK)
?
[Raw transfer]




06W_A_4(3SGY)
DYR_STAAU
[Raw transfer]




52V_X_3(3F0V)
?
[Raw transfer]




TOP_E_19(2W9S)
DYRA_STAAU
[Raw transfer]




TOP_D_16(2W9S)
DYRA_STAAU
[Raw transfer]




Q12_X_3(3SR5)
DYR_STAAU
[Raw transfer]




06W_B_6(3SGY)
DYR_STAAU
[Raw transfer]




1VN_X_3(4LAG)
?
[Raw transfer]




52V_A_5(3LG4)
DYR_STAAU
[Raw transfer]




55V_A_4(3FQC)
?
[Raw transfer]




52V_X_3(3F0Q)
?
[Raw transfer]




TOP_A_3(3TQ8)
?
[Raw transfer]




53R_X_3(3F0U)
?
[Raw transfer]




1VO_X_2(4LAH)
?
[Raw transfer]




Q20_X_2(3SRR)
DYR_STAAU
[Raw transfer]




I2H_X_3(3FY8)
DYR_STAAU
[Raw transfer]




5DR_A_4(3S9U)
?
[Raw transfer]




0U5_A_2(4FGG)
DYR_STAAU
[Raw transfer]




Q19_X_3(3SRQ)
DYR_STAAU
[Raw transfer]




55V_B_6(3FQC)
?
[Raw transfer]




53R_X_3(3F0B)
?
[Raw transfer]




GOL_E_17(2W9S)
DYRA_STAAU
[Raw transfer]




52V_B_6(3LG4)
DYR_STAAU
[Raw transfer]




XCF_X_3(3FY9)
DYR_STAAU
[Raw transfer]




DHF_X_3(3FRD)
DYR_STAAU
[Raw transfer]




NAP_X_2(3FRD)
DYR_STAAU
[Raw transfer]




NAP_A_2(3FQO)
?
[Raw transfer]




NAP_A_3(3FQZ)
?
[Raw transfer]




NAP_X_2(3FRA)
DYR_STAAU
[Raw transfer]




NAP_X_2(3F0V)
?
[Raw transfer]




NAP_X_2(3FY8)
DYR_STAAU
[Raw transfer]




NAP_A_3(3FQC)
?
[Raw transfer]




NAP_A_3(3LG4)
DYR_STAAU
[Raw transfer]




NAP_X_2(3F0Q)
?
[Raw transfer]




NAP_X_3(4LAH)
?
[Raw transfer]




NAP_X_2(4LEK)
?
[Raw transfer]




NAP_A_3(4FGG)
DYR_STAAU
[Raw transfer]




NAP_X_2(3FRE)
DYR_STAAU
[Raw transfer]




NAP_A_3(3SGY)
DYR_STAAU
[Raw transfer]




NAP_X_3(3SRS)
DYR_STAAU
[Raw transfer]




NAP_X_2(3FRF)
DYR_STAAU
[Raw transfer]




NDP_A_2(3TQ8)
?
[Raw transfer]




NAP_X_2(3F0B)
?
[Raw transfer]




NAP_X_2(4LAE)
?
[Raw transfer]




NAP_X_2(3F0X)
?
[Raw transfer]




NDP_A_8(2W9S)
DYRA_STAAU
[Raw transfer]




NAP_X_2(3FY9)
DYR_STAAU
[Raw transfer]




NAP_X_2(3SRU)
DYR_STAAU
[Raw transfer]




NAP_X_2(3F0S)
?
[Raw transfer]




NAP_X_2(3FRB)
DYR_STAAU
[Raw transfer]




NAP_A_3(3S9U)
?
[Raw transfer]




NAP_B_5(3FQC)
?
[Raw transfer]




NAP_X_2(3FYW)
DYR_STAAU
[Raw transfer]




NAP_A_2(3FQV)
?
[Raw transfer]




NDP_B_11(2W9S)
DYRA_STAAU
[Raw transfer]




NAP_B_5(3SGY)
DYR_STAAU
[Raw transfer]




NAP_B_4(3LG4)
DYR_STAAU
[Raw transfer]




NDP_A_2(2BL9)
DRTS_PLAVI
[Raw transfer]




NAP_B_4(3SH2)
DYR_STAAU
[Raw transfer]




NAP_A_2(3FQ0)
?
[Raw transfer]




NAP_X_3(3SRW)
DYR_STAAU
[Raw transfer]




NAP_X_3(3I8A)
DYR_STAAU
[Raw transfer]




NAP_X_2(3FYV)
DYR_STAAU
[Raw transfer]




NAP_A_3(3SH2)
DYR_STAAU
[Raw transfer]




NAP_X_3(3SRR)
DYR_STAAU
[Raw transfer]




NAP_X_2(3SQY)
DYR_STAAU
[Raw transfer]




NAP_X_2(4LAG)
?
[Raw transfer]




NAP_A_3(3FQF)
?
[Raw transfer]




NDP_C_14(2W9S)
DYRA_STAAU
[Raw transfer]




NAP_X_2(3SRQ)
DYR_STAAU
[Raw transfer]




NAP_X_2(3SR5)
DYR_STAAU
[Raw transfer]




NAP_X_2(3F0U)
?
[Raw transfer]




CP6_A_3(2BL9)
DRTS_PLAVI
[Raw transfer]




31 PsiBlast_CBE 98.2998%-153 - C5 -3SH2 12.9 DYR_STAAU
14 PsiBlast_PDB 98.0698%-148 - C5 -3FYV 12.4 DYR_STAAU
12 PsiBlast_PDB 98.0198%-153 - C5 -4LAH 13.1 ?
16 PsiBlast_PDB 97.7698%-154 - C5 -3FRD 12.7 DYR_STAAU
19 PsiBlast_PDB 97.7098%-152 - C5 -3SR5 13.4 DYR_STAAU
32 PsiBlast_CBE 97.6198%-151 - C5 -3SH2 13.0 DYR_STAAU
7 PsiBlast_PDB 97.5198%-155 - C5 -3SRS 13.2 DYR_STAAU
21 PsiBlast_CBE 97.5098%-150 - C5 -3FY9 12.6 DYR_STAAU
18 PsiBlast_PDB 97.4898%-153 - C5 -3FRF 11.5 DYR_STAAU
9 PsiBlast_PDB 97.4398%-154 - C5 -3SRW 13.2 DYR_STAAU
17 PsiBlast_PDB 97.4298%-150 - C5 -3FRE 12.3 DYR_STAAU
15 PsiBlast_PDB 97.4198%-146 - C5 -3FYW 12.4 DYR_STAAU
10 PsiBlast_PDB 97.2898%-151 - C5 -4LAE 13.0 ?
8 PsiBlast_PDB 97.1798%-154 - C5 -3SRU 13.3 DYR_STAAU
11 PsiBlast_PDB 97.1498%-151 - C5 -4LAG 13.0 ?
26 PsiBlast_CBE 97.0998%-153 - C5 -3FQC 13.2 ?
13 PsiBlast_PDB 97.0298%-151 - C5 -4LEK 13.2 ?
3 PsiBlast_PDB 96.9598%-147 - C5 -4FGG 11.9 DYR_STAAU
25 PsiBlast_CBE 96.9498%-151 - C5 -3FQC 12.8 ?
20 PsiBlast_PDB 96.9498%-150 - C5 -3FY8 12.5 DYR_STAAU
4 PsiBlast_PDB 96.8798%-152 - C5 -3SQY 13.3 DYR_STAAU
5 PsiBlast_PDB 96.7698%-150 - C5 -3SRQ 13.5 DYR_STAAU
36 PsiBlast_CBE 96.6798%-151 - C5 -3FQO 12.4 ?
6 PsiBlast_PDB 96.6598%-154 - C5 -3SRR 13.1 DYR_STAAU
23 PsiBlast_CBE 96.5898%-149 - C5 -3FRA 12.4 DYR_STAAU
28 PsiBlast_CBE 96.3298%-147 - C5 -3F0S 12.4 ?
27 PsiBlast_CBE 96.3298%-150 - C5 -3FQ0 13.0 ?
22 PsiBlast_CBE 96.3198%-155 - C5 -3FRB 12.7 DYR_STAAU
38 PsiBlast_CBE 96.0798%-147 - C5 -3F0X 10.7 ?
37 PsiBlast_CBE 96.0198%-144 - C5 -3FQF 12.2 ?
33 PsiBlast_CBE 95.9698%-145 - C5 -3SGY 12.9 DYR_STAAU
39 PsiBlast_CBE 95.7098%-150 - C5 -3F0V 13.0 ?
29 PsiBlast_CBE 95.6898%-149 - C5 -3F0Q 13.0 ?
34 PsiBlast_CBE 95.5898%-145 - C5 -3SGY 12.6 DYR_STAAU
35 PsiBlast_CBE 95.4398%-145 - C5 -3FQV 11.9 ?
40 PsiBlast_CBE 95.3598%-149 - C5 -3F0U 13.5 ?
24 PsiBlast_CBE 95.2698%-149 - C5 -3FQZ 11.5 ?
42 PsiBlast_CBE 95.1797%-152 - C5 -3LG4 11.9 DYR_STAAU
30 PsiBlast_CBE 95.0198%-150 - C5 -3F0B 12.7 ?
43 PsiBlast_CBE 94.8997%-149 - C5 -3I8A 12.9 DYR_STAAU
41 PsiBlast_CBE 94.4597%-152 - C5 -3LG4 11.9 DYR_STAAU
45 PsiBlast_CBE 90.4479%-142 - C5 -2W9S 4.9 DYRA_STAAU
49 PsiBlast_CBE 90.1579%-141 - C5 -2W9S 12.7 DYRA_STAAU
47 PsiBlast_CBE 90.0679%-140 - C5 -2W9S 12.6 DYRA_STAAU
44 PsiBlast_CBE 89.9379%-141 - C5 -2W9S 4.7 DYRA_STAAU
46 PsiBlast_CBE 89.8479%-140 - C5 -2W9S 4.9 DYRA_STAAU
48 PsiBlast_CBE 89.3679%-142 - C5 -2W9S 12.8 DYRA_STAAU
61 HHSearch 78.6442%-135 - C5 -3S9U 12.5 ?
60 HHSearch 77.7042%-141 * C5 *3TQ8 12.1 ?
66 HHSearch 62.9832%-100 - C5 -2BL9 11.9 DRTS_PLAVI