@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 123_tII_ORYSA: (2014-05-01 )
QAPPPVQCDPGKLSACAVPIFFGTAPSKSCCSNLRAQEKDGCFCQYARDPMYASYINSTNARNTIAACGIAFPSC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
12 HHSearch 91.9951%-128 - C5 -1L6H - NLTPX_ORYSJ -
1 Fugue 90.7950%-122 - C5 -1L6H - NLTPX_ORYSJ -
25 SP3 90.1046%-125 - C5 -1L6H - NLTPX_ORYSJ -
11 HHSearch 87.9854%-110 - C5 -1N89 5.2 NLT2G_WHEAT
13 HHSearch 69.2126% -90 - C5 -2RKN - DIRL1_ARATH -
2 Fugue 67.7926% -89 - C5 -2RKN - DIRL1_ARATH -
26 SP3 61.9522% -87 - C5 -1FK5 - NLTP_MAIZE -
3 Fugue 61.7816%-107 - C5 -1S6D - 2SS8_HELAN -
15 HHSearch 59.2528% -69 - C5 -2ALG - NLTP1_PRUPE -
29 SP3 57.5321%-100 * C5 *1HYP - ? -
9 Fugue 57.2521% -81 - C5 -1SZH - HER1_CAEEL -
19 HHSearch 56.2923% -70 - C5 -1T12 - NLTP1_TOBAC -
16 HHSearch 56.0027% -59 - C5 -1SIY - NLTP1_VIGRR -
32 SP3 50.9121% -92 - C5 -1QNT - MGMT_HUMAN -
18 HHSearch 50.4126% -65 - C5 -1AFH - NLTP_MAIZE -
14 HHSearch 49.0524% -53 - C5 -1BWO - NLTP1_WHEAT -
21 HHSearch 47.8627% -78 - C5 -1HYP - HPSE_SOYBN -
24 HHSearch 46.7223% -43 - C5 -3OB4 - ? -
30 SP3 40.6310% -76 - C5 -1XPJ - ? -
6 Fugue 39.4216% -90 - C2 -2FSD - ? -


User Run . : Multi Template Modeling Result:

(1 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
40 88.47100% -95 - C- -M040 - -