@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0087: (2015-11-28 )
MNEELLNEIPLLEDKAVFEIESASSLQDLEKVRLSYLGRKGVIKAYFDDLRKVEDTEKKRDLGAIINVLRNKLDQLIMNKESILKAEEVNFKLQNEAIDITLPVRPEKIGRAHPLSKVMNEVKLIFAHMGFRAVNGPDIEDEFHVFDALNTPSHHPAREEQDTFYLKNKINDKRMMLRTHTSSMQIRAMKKAKTFPIKIVAAGRVYRNDFDATHTPMFHQMEGLYVNENVNMGQLKFTIHHFLNKFFGDKELKIRFRNSFFPFTEPSAEVDISYKESKWIEVLGCGIVHPNVFQNVGIDHTKYSGFAFGIGIERLAMLKYQISDLRNFYDNKISWLSHYGFHFSSLR

Atome Classification :

(29 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

YSA_A_5(2ALY)
SYFA_THETH
[Raw transfer]




FYA_A_4(1B7Y)
SYFA_THETH
[Raw transfer]




FYA_A_4(1B7Y)
SYFA_THETH
[Raw transfer]




FA5_A_5(1JJC)
SYFA_THET8
[Raw transfer]




TYR_A_5(2AMC)
SYFA_THETH
[Raw transfer]




PHE_A_3(4TVA)
SYFA_THETH
[Raw transfer]




PHE_A_4(1B70)
SYFA_THETH
[Raw transfer]




200_A_5(2AKW)
SYFA_THETH
[Raw transfer]




GAX_A_4(2RHQ)
SYFA_STAHJ
[Raw transfer]




DAH_A_3(3TEH)
SYFA_THETH
[Raw transfer]




MTY_A_3(3HFZ)
SYFA_THET8
[Raw transfer]




GAX_A_4(2RHQ)
SYFA_STAHJ
[Raw transfer]




21 PsiBlast_CBE 93.3748% -91 - C4 -3PCO - ? -
37 Fugue 93.0839% -82 - C4 -1EIY - SYFA_THET8 -
10 PsiBlast_PDB 92.5337% -84 - C4 -1EIY - SYFA_THET8 -
13 PsiBlast_PDB 91.9637% -85 - C4 -2IY5 - SYFA_THETH -
29 PsiBlast_CBE 89.4033%-101 - C4 -3L4G - SYFA_HUMAN -
8 PsiBlast_PDB 89.2545%-109 - C4 -2RHS - SYFA_STAHJ -
2 PsiBlast_PDB 89.2043%-111 - C4 -4P71 - SYFA_PSEAE -
26 PsiBlast_CBE 88.8545%-107 - C4 -2RHS - SYFA_STAHJ -
7 PsiBlast_PDB 88.4545%-106 - C4 -2RHQ 7.0 SYFA_STAHJ
4 PsiBlast_PDB 88.2143%-109 - C4 -4P73 - SYFA_PSEAE -
24 PsiBlast_CBE 88.0143%-110 - C4 -4P73 - SYFA_PSEAE -
3 PsiBlast_PDB 87.5543%-108 - C4 -4P72 - SYFA_PSEAE -
6 PsiBlast_PDB 87.5443%-108 - C4 -4P75 - SYFA_PSEAE -
5 PsiBlast_PDB 87.4943%-108 - C4 -4P74 - SYFA_PSEAE -
23 PsiBlast_CBE 87.3543%-109 - C4 -4P74 - SYFA_PSEAE -
25 PsiBlast_CBE 87.2143%-109 - C4 -4P72 - SYFA_PSEAE -
1 PsiBlast_PDB 86.9548%-110 - C4 -3PCO - ? -
22 PsiBlast_CBE 86.8543%-109 - C4 -4P75 - SYFA_PSEAE -
17 PsiBlast_PDB 86.5642% -96 - C4 -2AKW 4.4 SYFA_THETH
18 PsiBlast_PDB 86.2842% -91 - C4 -2ALY 9.8 SYFA_THETH
19 PsiBlast_PDB 85.9942% -98 - C4 -2AMC 3.8 SYFA_THETH
48 HHSearch 85.3939%-103 - C4 -1B7Y 8.9 SYFA_THETH
16 PsiBlast_PDB 85.1137% -97 - C4 -4TVA 4.6 SYFA_THETH
12 PsiBlast_PDB 85.0737% -95 - C4 -1JJC 9.8 SYFA_THET8
9 PsiBlast_PDB 84.8537% -99 - C4 -1B7Y 8.9 SYFA_THETH
49 HHSearch 84.8141% -99 - C4 -2RHQ 5.7 SYFA_STAHJ
11 PsiBlast_PDB 84.1937% -92 - C4 -1B70 4.0 SYFA_THETH
14 PsiBlast_PDB 83.8737% -95 - C4 -3HFZ 4.3 SYFA_THET8
15 PsiBlast_PDB 83.7837% -97 - C4 -3TEH 3.1 SYFA_THETH