@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0114: (2015-11-28 )
MPKLSIVVAPDERLTTRASEVTGINDKIKELVNDMFETMYNAEGLGLAAVQIGVLKRIFVMDIQLEDIKGEPVGYESTGKFCMINPEITELSDEQVILKEGCLSIPEQSHEIRRPKYLTVKYKDLNNKEQTLKASGWLARCIQHELDHLNGILYIRHLSKLKYDMAMKKAEKFKRHYER

Atome Classification :

(76 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2BB_B_7(3K6L)
DEF_ECOLI
[Raw transfer]




2BB_A_5(3K6L)
DEF_ECOLI
[Raw transfer]




BB1_C_9(1G27)
DEF_ECOLI
[Raw transfer]




BB1_B_8(1G27)
DEF_ECOLI
[Raw transfer]




BB2_A_3(1WS1)
DEF1_BACCR
[Raw transfer]




BB1_A_7(1G27)
DEF_ECOLI
[Raw transfer]




BB2_C_11(1LRU)
DEF_ECOLI
[Raw transfer]




BB2_A_5(3U04)
?
[Raw transfer]




BB2_A_5(3U04)
?
[Raw transfer]




BB2_A_7(1G2A)
DEF_ECOLI
[Raw transfer]




BB2_A_9(1LRU)
DEF_ECOLI
[Raw transfer]




BB2_A_3(1LRY)
DEF_PSEAE
[Raw transfer]




BB2_D_17(4DR9)
?
[Raw transfer]




BB2_B_7(1IX1)
DEF_PSEAE
[Raw transfer]




BB2_B_10(1LRU)
DEF_ECOLI
[Raw transfer]




BB2_B_8(1G2A)
DEF_ECOLI
[Raw transfer]




BB2_A_7(1G2A)
DEF_ECOLI
[Raw transfer]




BB2_C_9(1G2A)
DEF_ECOLI
[Raw transfer]




BB2_A_7(1G2A)
DEF_ECOLI
[Raw transfer]




BB2_C_14(4DR9)
?
[Raw transfer]




BB2_A_5(1IX1)
DEF_PSEAE
[Raw transfer]




BB2_A_5(3UWB)
?
[Raw transfer]




GNR_B_6(1S17)
DEF_PSEAE
[Raw transfer]




MLN_A_4(1BSJ)
DEF_ECOLI
[Raw transfer]




MLN_A_4(1BSK)
DEF_ECOLI
[Raw transfer]




BB2_B_10(4DR9)
?
[Raw transfer]




FMT_A_3(1XEO)
DEF_ECOLI
[Raw transfer]




GOL_A_7(1N5N)
DEF_PSEAE
[Raw transfer]




FMT_A_3(1XEO)
DEF_ECOLI
[Raw transfer]




SB7_A_7(2AI8)
DEF_ECOLI
[Raw transfer]




GNR_A_5(1S17)
DEF_PSEAE
[Raw transfer]




FMT_A_3(1XEN)
DEF_ECOLI
[Raw transfer]




FMT_A_3(1XEM)
DEF_ECOLI
[Raw transfer]




GOL_A_7(1N5N)
DEF_PSEAE
[Raw transfer]




SB7_B_8(2AI8)
DEF_ECOLI
[Raw transfer]




GOL_B_6(1N5N)
DEF_PSEAE
[Raw transfer]




FMT_B_11(4DR8)
?
[Raw transfer]




SB7_C_9(2AI8)
DEF_ECOLI
[Raw transfer]




FMT_A_13(1Y6H)
DEF_LEPIN
[Raw transfer]




NVC_A_3(3E3U)
DEF_MYCTU
[Raw transfer]




FMT_A_3(2W3U)
DEF_ECOLI
[Raw transfer]




FMT_A_5(1XEN)
DEF_ECOLI
[Raw transfer]




FMT_C_14(4DR8)
?
[Raw transfer]




BRR_B_7(1RL4)
?
[Raw transfer]




FMT_B_17(1VEZ)
DEF_LEPIN
[Raw transfer]




BRR_A_5(1RL4)
?
[Raw transfer]




2PE_A_9(1BSZ)
DEF_ECOLI
[Raw transfer]




BRR_A_5(1RL4)
?
[Raw transfer]




FMT_B_9(1VEV)
DEF_LEPIN
[Raw transfer]




FMT_A_7(4DR8)
?
[Raw transfer]




2PE_B_10(1BSZ)
DEF_ECOLI
[Raw transfer]




FMT_D_16(4DR8)
?
[Raw transfer]




2PE_C_11(1BS4)
DEF_ECOLI
[Raw transfer]




2PE_A_9(1BS4)
DEF_ECOLI
[Raw transfer]




2PE_C_11(1ICJ)
DEF_ECOLI
[Raw transfer]




2PE_A_9(1ICJ)
DEF_ECOLI
[Raw transfer]




2PE_B_10(1ICJ)
DEF_ECOLI
[Raw transfer]




2PE_C_11(1BSZ)
DEF_ECOLI
[Raw transfer]




2PE_B_10(1BS4)
DEF_ECOLI
[Raw transfer]




2PE_A_9(1BS4)
DEF_ECOLI
[Raw transfer]




EOH_A_4(2W3T)
DEF_ECOLI
[Raw transfer]




EOH_A_4(2W3T)
DEF_ECOLI
[Raw transfer]




H2S_A_5(4AL2)
DEF_ECOLI
[Raw transfer]




H2S_B_7(4AL2)
DEF_ECOLI
[Raw transfer]




H2S_C_9(4AL2)
DEF_ECOLI
[Raw transfer]




CHAIN_D_4(1BS8)
DEF_ECOLI
[Raw transfer]

-

CHAIN_E_5(1BS6)
DEF_ECOLI
[Raw transfer]

-

CHAIN_F_6(1BS6)
DEF_ECOLI
[Raw transfer]

-

CHAIN_E_5(1BS8)
DEF_ECOLI
[Raw transfer]

-

CHAIN_F_6(1BS8)
DEF_ECOLI
[Raw transfer]

-

CHAIN_D_4(1BS6)
DEF_ECOLI
[Raw transfer]

-

21 PsiBlast_CBE 97.2348%-100 - C7 -3OCA - ? -
1 PsiBlast_PDB 96.9948%-107 - C7 -3U04 7.0 ?
101 HHSearch 96.1249%-107 - C7 -3U04 7.0 ?
2 PsiBlast_PDB 95.3048% -98 - C7 -3OCA - ? -
23 PsiBlast_CBE 88.4044% -93 - C7 -1N5N 2.8 DEF_PSEAE
125 Fugue 87.9543% -94 - C7 -1BS4 4.7 DEF_ECOLI
22 PsiBlast_CBE 87.3144% -93 - C7 -1S17 3.9 DEF_PSEAE
5 PsiBlast_PDB 86.9644% -92 - C7 -1IX1 4.9 DEF_PSEAE
57 PsiBlast_CBE 86.7042%-102 - C7 -1BS8 3.7 DEF_ECOLI
3 PsiBlast_PDB 86.6844% -92 - C7 -1N5N 2.5 DEF_PSEAE
67 PsiBlast_CBE 86.6535% -98 - C7 -3QU1 - DEF2_VIBCH -
103 HHSearch 86.4845%-100 - C7 -1N5N 2.5 DEF_PSEAE
4 PsiBlast_PDB 86.4844% -90 - C7 -1S17 3.8 DEF_PSEAE
66 PsiBlast_CBE 86.3335% -98 - C7 -3QU1 - DEF2_VIBCH -
45 PsiBlast_CBE 86.2842%-102 - C7 -1ICJ 4.3 DEF_ECOLI
15 PsiBlast_PDB 86.1042%-104 - C7 -1BS5 - DEF_ECOLI -
61 PsiBlast_CBE 86.0642%-102 - C7 -1BS6 3.6 DEF_ECOLI
9 PsiBlast_PDB 86.0642%-101 - C7 -3K6L 5.4 DEF_ECOLI
102 HHSearch 85.9943% -98 - C7 -1XEO 3.5 DEF_ECOLI
63 PsiBlast_CBE 85.9642%-104 - C7 -1BS5 - DEF_ECOLI -
29 PsiBlast_CBE 85.9639%-111 - C7 -4DR8 3.3 ?
33 PsiBlast_CBE 85.8442%-113 - C7 -4AL2 2.8 DEF_ECOLI
13 PsiBlast_PDB 85.8042%-100 - C7 -1ICJ 4.5 DEF_ECOLI
54 PsiBlast_CBE 85.7142%-102 - C7 -1BSZ 4.6 DEF_ECOLI
14 PsiBlast_PDB 85.6342% -99 - C7 -1BS4 4.7 DEF_ECOLI
18 PsiBlast_PDB 85.5942%-105 - C7 -1BS8 3.2 DEF_ECOLI
19 PsiBlast_PDB 85.5842%-100 - C7 -1BSZ 5.0 DEF_ECOLI
44 PsiBlast_CBE 85.5242%-101 - C7 -1ICJ 5.1 DEF_ECOLI
12 PsiBlast_PDB 85.5042%-102 - C7 -2W3U 3.4 DEF_ECOLI
24 PsiBlast_CBE 85.4544% -94 - C7 -1IX1 6.1 DEF_PSEAE
16 PsiBlast_PDB 85.4542%-107 - C7 -1BS6 3.2 DEF_ECOLI
34 PsiBlast_CBE 85.3942%-109 - C7 -4AL2 2.8 DEF_ECOLI
107 HHSearch 85.3644% -97 - C7 -2W3T 2.4 DEF_ECOLI
64 PsiBlast_CBE 85.3542%-102 - C7 -1BS4 4.7 DEF_ECOLI
32 PsiBlast_CBE 85.3342% -99 - C7 -3K6L 4.9 DEF_ECOLI
39 PsiBlast_CBE 85.2542%-101 - C7 -1XEN 3.5 DEF_ECOLI
60 PsiBlast_CBE 85.2042%-103 - C7 -1BS6 3.6 DEF_ECOLI
55 PsiBlast_CBE 85.1242%-104 - C7 -1BSK 5.8 DEF_ECOLI
40 PsiBlast_CBE 85.0842%-101 - C7 -1XEM 3.6 DEF_ECOLI
10 PsiBlast_PDB 85.0242%-106 - C7 -4AL2 2.8 DEF_ECOLI
6 PsiBlast_PDB 85.0243% -96 - C7 -1LRY 5.9 DEF_PSEAE
126 Fugue 84.9043% -98 - C7 -1G2A 5.7 DEF_ECOLI
37 PsiBlast_CBE 84.8742%-101 - C7 -2AI8 3.5 DEF_ECOLI
28 PsiBlast_CBE 84.8639%-106 - C7 -4DR8 3.1 ?
51 PsiBlast_CBE 84.8142%-102 - C7 -1G27 5.1 DEF_ECOLI
26 PsiBlast_CBE 84.6639%-113 - C7 -4DR9 6.2 ?
48 PsiBlast_CBE 84.6242%-103 - C7 -1G2A 5.8 DEF_ECOLI
20 PsiBlast_PDB 84.5942%-103 - C7 -1BSJ 5.7 DEF_ECOLI
35 PsiBlast_CBE 84.5642%-101 - C7 -2AI8 3.8 DEF_ECOLI
65 PsiBlast_CBE 84.5042%-100 - C7 -1BS4 4.4 DEF_ECOLI
8 PsiBlast_PDB 84.4439%-110 - C7 -4DR8 3.3 ?
47 PsiBlast_CBE 84.2942%-101 - C7 -1G2A 5.9 DEF_ECOLI
38 PsiBlast_CBE 84.1742%-101 - C7 -1XEO 3.5 DEF_ECOLI
42 PsiBlast_CBE 84.0842% -99 - C7 -1LRU 6.4 DEF_ECOLI
53 PsiBlast_CBE 83.7542%-102 - C7 -1BSZ 3.8 DEF_ECOLI
43 PsiBlast_CBE 83.6542%-103 - C7 -1LRU 5.4 DEF_ECOLI
11 PsiBlast_PDB 83.6442%-101 - C7 -2W3T 2.4 DEF_ECOLI
124 Fugue 83.6342%-104 * C7 *1G2A 5.7 DEF_ECOLI
30 PsiBlast_CBE 83.5839%-111 - C7 -4DR8 3.3 ?
46 PsiBlast_CBE 83.5742%-102 - C7 -1G2A 6.3 DEF_ECOLI
25 PsiBlast_CBE 83.5039%-109 - C7 -4DR9 6.4 ?
56 PsiBlast_CBE 83.4242%-104 - C7 -1BS8 2.7 DEF_ECOLI
27 PsiBlast_CBE 83.3739%-111 - C7 -4DR9 6.2 ?
36 PsiBlast_CBE 83.3442%-104 - C7 -2AI8 3.7 DEF_ECOLI
49 PsiBlast_CBE 83.3142%-101 - C7 -1G27 4.4 DEF_ECOLI
68 PsiBlast_CBE 83.0634%-101 - C7 -1RL4 4.2 ?
110 HHSearch 82.9035%-103 - C7 -1RL4 4.0 ?
50 PsiBlast_CBE 82.5342%-100 - C7 -1G27 4.5 DEF_ECOLI
69 PsiBlast_CBE 82.5034%-103 - C7 -1RL4 4.0 ?
41 PsiBlast_CBE 81.7342%-104 - C7 -1LRU 5.5 DEF_ECOLI
76 PsiBlast_CBE 80.0439% -99 - C7 -1WS1 6.9 DEF1_BACCR
114 HHSearch 78.5030% -82 - C7 -3E3U 5.4 DEF_MYCTU
109 HHSearch 75.9838%-101 - C7 -3UWB 5.9 ?
112 HHSearch 75.6432% -87 - C7 -1Y6H 3.4 DEF_LEPIN
80 PsiBlast_CBE 69.8738%-104 - C7 -1VEZ 3.4 DEF_LEPIN
84 PsiBlast_CBE 69.2938%-103 - C7 -1VEV 3.1 DEF_LEPIN