@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA0128: (2016-03-12 )
MAFKLPNLPYAYDALEPYIDQRTMEFHHDKHHNTYVTKLNATVEGTELEHQSLADMIANLDKVPEAMRMSVRNNGGGHFNHSLFWEILSPNSEEKGGVIDDIKAQWGTLDEFKNEFANKATTLFGSGWTWLVVNDGKLEIVTTPNQDNPLTEGKTPILLFDVWEHAYYLKYQNKRPDYMTAFWNIVNWKKVDELYQAAK

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PEO_D_11(3K9S)
SODM_ECOLI
[Raw transfer]



PEO_C_9(3K9S)
SODM_ECOLI
[Raw transfer]



O_A_9(2NYB)
SODF_ECOLI
[Raw transfer]



PEO_B_7(3K9S)
SODM_ECOLI
[Raw transfer]
21 PsiBlast_CBE 94.3262% -81 - C8 -2RCV - SODM_BACSU -
2 PsiBlast_PDB 94.1360% -77 - C8 -1XUQ - SODM1_BACAN -
1 PsiBlast_PDB 93.4062% -80 - C8 -2RCV - SODM_BACSU -
26 PsiBlast_CBE 93.3660% -76 - C8 -1XUQ - SODM1_BACAN -
23 PsiBlast_CBE 93.0562% -79 - C8 -2RCV - SODM_BACSU -
25 PsiBlast_CBE 92.5362% -78 - C8 -2RCV - SODM_BACSU -
27 PsiBlast_CBE 92.4553% -96 - C8 -3KKY - SODM_DEIRA -
22 PsiBlast_CBE 92.1562% -81 - C8 -2RCV - SODM_BACSU -
33 PsiBlast_CBE 92.1053% -86 - C8 -1Y67 - SODM_DEIRA -
30 PsiBlast_CBE 92.0553% -91 - C8 -2CDY - SODM_DEIRA -
3 PsiBlast_PDB 92.0563% -80 - C8 -1JR9 - SODM_VIRHA -
101 HHSearch 91.9657% -83 - C8 -3KKY - SODM_DEIRA -
24 PsiBlast_CBE 91.9462% -77 - C8 -2RCV - SODM_BACSU -
5 PsiBlast_PDB 91.9453% -89 - C8 -2CDY - SODM_DEIRA -
10 PsiBlast_PDB 91.8350% -84 - C8 -1XRE - SODM2_BACAN -
34 PsiBlast_CBE 91.8153% -92 - C8 -1Y67 - SODM_DEIRA -
28 PsiBlast_CBE 91.5353% -93 - C8 -2CE4 - SODM_DEIRA -
106 HHSearch 91.4751% -81 - C8 -1XRE - SODM2_BACAN -
4 PsiBlast_PDB 91.3953% -94 - C8 -3KKY - SODM_DEIRA -
29 PsiBlast_CBE 91.3853% -90 - C8 -2CDY - SODM_DEIRA -
114 HHSearch 84.7749% -78 * C8 *2NYB 2.8 SODF_ECOLI
41 PsiBlast_CBE 82.1447% -74 - C8 -3K9S 3.4 SODM_ECOLI
40 PsiBlast_CBE 82.0047% -75 - C8 -3K9S 3.8 SODM_ECOLI
42 PsiBlast_CBE 81.0947% -77 - C8 -3K9S 3.6 SODM_ECOLI