@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0862: (2016-03-19 )
LEFWRRSVFYEIYMKSFQDSNGDGLGDFKGLTSRLDYLVDLGIDGIWLTPFYPSPQVDNGYDVSDYCDINPDYGDMTDFRAFMKAADARGIKVIIDLVLNHSSTEHTWFKESRSSKTNPKRDYYIWREKPNNWESFFGGSAWEKDELTGEYYYHSFAKEQADLNWANEAVRAEMEQVLAFWLNEGVAGFRLDVINNLTLVLEFPDNPVASGEMEHVYDRNQSGLEQALEDIASFCRKERDVFLVGEISSDKLPEIARYSSKKMLDVTFNFNFGSVDQLDAKSVFTTLNEMETALNEGQWPTLFFGSHDMSRFRSRLASGDIVKTQLLAFLMLTAKGVPFIYYGEEVGMPDLTFSSVKEMRDIQGTAAYYQALQTGTDEKQALEIAIEKTRDKARGPMIFPDGKPFTLGEPWIKMATLPEEEARMMWDFYQALLAFRKENDFKEMEYTFLKLDGEVLSYQRGEFIFLLHFGEEEITYPLQGNYQLVFGEAMMVENGIRMGAHTGIALRVEE

Atome Classification :

(65 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SUC_A_4(4HPH)
?
[Raw transfer]




SUC_A_4(4H8U)
?
[Raw transfer]




SUC_A_3(2PWE)
?
[Raw transfer]




SUC_B_4(2PWE)
?
[Raw transfer]




TEU_A_4(4H8V)
?
[Raw transfer]




TEU_B_6(4H8V)
?
[Raw transfer]




GLC_A_2(3AXI)
MALX3_YEAST
[Raw transfer]




ISL_A_4(4HA1)
?
[Raw transfer]




BGC_B_10(3WY3)
?
[Raw transfer]




BGC_A_6(3WY3)
?
[Raw transfer]




GLC_A_2(3A4A)
MALX3_YEAST
[Raw transfer]




GLC_A_4(4H7V)
?
[Raw transfer]




CTS_B_6(2PWG)
?
[Raw transfer]




GLC_B_6(4H7V)
?
[Raw transfer]




NOJ_A_11(3GBE)
?
[Raw transfer]




GLC_A_4(4HOZ)
?
[Raw transfer]




NOJ_B_6(2PWD)
?
[Raw transfer]




NOJ_A_5(2PWD)
?
[Raw transfer]




GLC_A_4(4HP5)
?
[Raw transfer]




CTS_A_5(2PWG)
?
[Raw transfer]




TEU_B_6(4H8U)
?
[Raw transfer]




GLC_A_2(3AXH)
MALX3_YEAST
[Raw transfer]




SUGAR_A_2(2ZID)
DEXB_STRMU
[Raw transfer]

-

TRS_B_6(4GO8)
?
[Raw transfer]




GLC_B_6(4HA1)
?
[Raw transfer]




GOL_B_10(4GI6)
?
[Raw transfer]




GOL_A_5(4GI8)
?
[Raw transfer]




TRS_B_6(1ZJA)
?
[Raw transfer]




TRS_B_6(1ZJB)
?
[Raw transfer]




GOL_B_15(4GI8)
?
[Raw transfer]




BGC_A_2(4WLC)
?
[Raw transfer]




BGC_A_8(3WY2)
?
[Raw transfer]




GOL_B_12(4GIA)
?
[Raw transfer]




TRS_A_5(1ZJB)
?
[Raw transfer]




GOL_B_8(4GI9)
?
[Raw transfer]




GOL_A_5(4GI6)
?
[Raw transfer]




GLO_A_3(4M56)
O16G1_BACSU
[Raw transfer]




GOL_A_5(4GI9)
?
[Raw transfer]




BGC_A_8(3WY2)
?
[Raw transfer]




GOL_A_5(4GIA)
?
[Raw transfer]




TRS_A_2(4M8U)
O16G1_BACSU
[Raw transfer]




GOL_A_3(4H2C)
?
[Raw transfer]




TRS_A_4(4GO8)
?
[Raw transfer]




GOL_A_3(4GIN)
?
[Raw transfer]




TRS_A_2(4MAZ)
O16G1_BACSU
[Raw transfer]




TRS_A_4(4GO9)
?
[Raw transfer]




TRS_B_6(4GO9)
?
[Raw transfer]




GOL_A_3(4HOW)
?
[Raw transfer]




TRS_A_2(4MB1)
O16G1_BACSU
[Raw transfer]




GOL_B_11(3WY2)
?
[Raw transfer]




TRS_A_5(1ZJA)
?
[Raw transfer]




TRS_A_5(2ZIC)
DEXB_STRMU
[Raw transfer]




TRS_A_5(1ZJA)
?
[Raw transfer]




GLO_B_7(4M56)
O16G1_BACSU
[Raw transfer]




TRS_A_2(4HOX)
?
[Raw transfer]




GOL_A_7(4H2C)
?
[Raw transfer]




GOL_A_9(4FLR)
AMYS_NEIPO
[Raw transfer]




GOL_A_3(4FLQ)
AMYS_NEIPO
[Raw transfer]




GOL_A_14(3UCQ)
?
[Raw transfer]




EDO_A_4(3GBD)
?
[Raw transfer]




TUR_A_2(3UER)
?
[Raw transfer]




EDO_A_2(3GBD)
?
[Raw transfer]




BGC_A_2(1S46)
AMYS_NEIPO
[Raw transfer]




114 HHSearch 86.5135% -74 - C1 -1ZJA 2.6 ?
44 PsiBlast_CBE 86.0735% -78 - C1 -4MB1 3.4 O16G1_BACSU
46 PsiBlast_CBE 85.4135% -79 - C1 -4MAZ 4.4 O16G1_BACSU
45 PsiBlast_CBE 84.6335% -77 - C1 -4M8U 3.1 O16G1_BACSU
112 HHSearch 84.5637% -74 - C1 -1UOK - O16G_BACCE -
102 Fugue 82.0839% -69 - C1 -1UOK - ? -
43 PsiBlast_CBE 81.7035% -76 - C1 -4M56 2.5 O16G1_BACSU
42 PsiBlast_CBE 81.5135% -75 - C1 -4M56 2.8 O16G1_BACSU
116 HHSearch 81.4432% -74 - C1 -3WY2 3.7 ?
2 PsiBlast_PDB 80.9735% -73 - C1 -4GIN 2.9 ?
49 PsiBlast_CBE 80.9631% -72 - C1 -4HPH 4.7 ?
50 PsiBlast_CBE 80.7831% -75 - C1 -4HP5 4.8 ?
62 PsiBlast_CBE 80.5332% -71 - C1 -3AXH 4.2 MALX3_YEAST
1 PsiBlast_PDB 80.0035% -71 - C1 -1UOK - O16G_BACCE -
9 PsiBlast_PDB 79.3237% -69 - C1 -2PWH - ? -
57 PsiBlast_CBE 79.2132% -75 - C1 -3GBD 3.0 ?
31 PsiBlast_CBE 79.1737% -68 - C1 -4GI9 2.9 ?
13 PsiBlast_PDB 79.1137% -68 - C1 -4GI6 2.6 ?
23 PsiBlast_CBE 79.0137% -69 - C1 -1ZJB 4.3 ?
48 PsiBlast_CBE 78.8531% -73 - C1 -4HOX 3.0 ?
51 PsiBlast_CBE 78.8331% -76 - C1 -4HOZ 4.0 ?
29 PsiBlast_CBE 78.6237% -68 - C1 -4GO9 3.0 ?
30 PsiBlast_CBE 78.5137% -68 - C1 -4GIA 2.9 ?
5 PsiBlast_PDB 78.3637% -70 - C1 -1ZJB 4.2 ?
4 PsiBlast_PDB 78.3637% -68 - C1 -1ZJA 2.6 ?
6 PsiBlast_PDB 78.3537% -66 - C1 -2PWD 4.0 ?
47 PsiBlast_CBE 78.2231% -73 * C1 *4HOW 3.1 ?
33 PsiBlast_CBE 78.1437% -66 - C1 -4GI6 2.8 ?
24 PsiBlast_CBE 78.1037% -69 - C1 -1ZJA 4.4 ?
56 PsiBlast_CBE 78.0732% -71 - C1 -3GBE 3.4 ?
59 PsiBlast_CBE 78.0532% -69 - C1 -3A4A 4.1 MALX3_YEAST
38 PsiBlast_CBE 77.8337% -69 - C1 -4HA1 4.2 ?
61 PsiBlast_CBE 77.7832% -68 - C1 -3AXI 3.7 MALX3_YEAST
11 PsiBlast_PDB 77.5037% -67 - C1 -2PWE 4.1 ?
12 PsiBlast_PDB 77.4937% -67 - C1 -4GO9 4.4 ?
15 PsiBlast_PDB 77.4237% -67 - C1 -4GI9 3.8 ?
22 PsiBlast_CBE 77.3037% -67 - C1 -2PWD 4.0 ?
7 PsiBlast_PDB 77.1937% -67 - C1 -4H8V 4.1 ?
19 PsiBlast_PDB 77.1237% -66 - C1 -4H7V 4.8 ?
14 PsiBlast_PDB 77.1237% -69 - C1 -4GI8 4.2 ?
41 PsiBlast_CBE 77.0837% -67 - C1 -4H7V 3.4 ?
32 PsiBlast_CBE 77.0737% -67 - C1 -4GI8 3.0 ?
3 PsiBlast_PDB 77.0537% -70 - C1 -4H2C 3.9 ?
27 PsiBlast_CBE 77.0437% -66 - C1 -4GO8 4.3 ?
21 PsiBlast_CBE 77.0437% -68 - C1 -4H8V 3.0 ?
16 PsiBlast_PDB 77.0437% -68 - C1 -4GIA 3.0 ?
8 PsiBlast_PDB 76.7837% -67 - C1 -2PWG 4.5 ?
10 PsiBlast_PDB 76.6337% -66 - C1 -4GO8 2.9 ?
39 PsiBlast_CBE 76.5937% -68 - C1 -4HA1 3.9 ?
28 PsiBlast_CBE 76.3037% -68 - C1 -2PWE 3.9 ?
40 PsiBlast_CBE 76.1537% -67 - C1 -4H8U 3.1 ?
69 PsiBlast_CBE 75.9431% -72 - C1 -3WY3 4.0 ?
26 PsiBlast_CBE 75.8937% -67 - C1 -2PWG 3.2 ?
63 PsiBlast_CBE 75.7731% -72 - C1 -3WY2 3.2 ?
52 PsiBlast_CBE 75.7534% -66 - C1 -2ZIC 3.5 DEXB_STRMU
68 PsiBlast_CBE 75.5431% -71 - C1 -3WY3 3.9 ?
54 PsiBlast_CBE 75.4033% -67 - C1 -4WLC 4.7 ?
20 PsiBlast_PDB 75.1637% -69 - C1 -4H8U 3.8 ?
55 PsiBlast_CBE 74.2433% -66 - C1 -2ZID 4.5 DEXB_STRMU
64 PsiBlast_CBE 73.0831% -69 - C1 -3WY2 3.7 ?
98 PsiBlast_CBE 28.1832% -57 - C1 -4FLQ 3.1 AMYS_NEIPO
100 PsiBlast_CBE 26.8532% -54 - C1 -4FLR 2.7 AMYS_NEIPO
88 PsiBlast_CBE 26.5532% -57 - C1 -1S46 3.1 AMYS_NEIPO
85 PsiBlast_CBE 26.0734% -47 - C1 -3UER 2.4 ?
86 PsiBlast_CBE 25.6134% -50 - C1 -3UCQ 2.7 ?