@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1104: (2016-03-21 )
MKLVKYFAIFGVVFSMFFSLLLFVTIVFAEEDDTRSSREEMIQQGGLNVSAEVLAHRPMVEKYCKEFGIEEYVNYILAIMQVESGGTAEDVMQSSESLGLPPNSLSTEESIKQGCKYFSELLASAESNGCDINTVIQSYNYGGGFINYVASNGKKYSYELAESFSKDKAGGVKVDYPNPIAIPVNGGWRYNYGNQFYVLLVSQYLTPVQFDDETVQAIMNEALKYEGYPYVFGGSSPSTSFDCSGLTQWSYAVAGIQLPRVAQAQYDATQHIPLSEAKAGDLVFFHSTYDAGSYVTHVGIYVGNNQMYHAGDPIGYTNLTDSYWQAHLIGAGRIIK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

UNL_A_4(2HBW)
?
[Raw transfer]




1 PsiBlast_PDB 72.2574% -2 - C2 -4FDY - ? -
45 Fugue 69.7173% -8 - C2 -4FDY - ? -
7 PsiBlast_PDB 64.2338%-100 - C2 -2FG0 - ? -
6 PsiBlast_PDB 64.1538% -94 - C2 -2EVR - ? -
26 HHSearch 63.1741%-102 - C2 -2HBW 4.6 ?
8 PsiBlast_PDB 62.3537% -96 - C2 -2HBW - ? -
24 HHSearch 61.4236%-108 - C2 -3PBI - RIPB_MYCTU -
22 HHSearch 60.1233% -98 - C2 -2K1G - MEPS_ECOLI -
4 PsiBlast_PDB 58.2335% -77 - C2 -3I86 - ? -
21 PsiBlast_CBE 57.1135% -68 - C2 -3I86 - ? -
2 PsiBlast_PDB 56.8234% -98 - C2 -2K1G - MEPS_ECOLI -
15 PsiBlast_PDB 56.1232% -74 - C2 -4Q4G - RIPA_MYCTU -
10 PsiBlast_PDB 56.0933% -71 - C2 -3PBC - RIPA_MYCTU -
12 PsiBlast_PDB 56.0132% -71 - C2 -3S0Q - RIPA_MYCTU -
17 PsiBlast_PDB 55.8029% -84 - C2 -4JXB - ? -
9 PsiBlast_PDB 55.7533% -72 - C2 -3NE0 - -
14 PsiBlast_PDB 55.5532% -80 - C2 -4Q4N - RIPA_MYCTU -
11 PsiBlast_PDB 55.4233% -72 - C2 -4Q4T - RIPA_MYCTU -
47 Fugue 55.2424% -57 - C2 -2EVR - ? -
3 PsiBlast_PDB 54.7036% -83 - C2 -3PBI - RIPB_MYCTU -