@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1901: (2016-03-30 )
MLIIRNKQELKEVILKQKQANKTIGFVPTMGFLHEGHMTLVSHARKESDFVVMSVFVNPTQFGPNEDFDAYPRDEAHDAKLAEEGGVDILFVPTVEEIYPTELSTKLHVDKRVSVLDGADREGHFDGVVTVLTKLFHLVSPDNAYFGQKDAQQVAVVSGLVEDYFFPVNLRIIATVREADGLAKSSRNVYLTEKERKEAPVIHEALQLGRKLIESGETNQAKIVQMMTEKINEQTSHELIAYLAIYSYPEFTPVTDWSKGIIIAAAVKYSKARLIDNELINVKRR

Atome Classification :

(108 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PAJ_B_9(3AG6)
PANC_STAA8
[Raw transfer]




PAJ_A_3(3AG6)
PANC_STAA8
[Raw transfer]




PAJ_A_3(3AG6)
PANC_STAA8
[Raw transfer]




ATP_C_9(3INN)
PANC_BRUME
[Raw transfer]




ATP_A_5(3INN)
PANC_BRUME
[Raw transfer]




ATP_D_13(3INN)
PANC_BRUME
[Raw transfer]




ATP_A_5(3INN)
PANC_BRUME
[Raw transfer]




APC_B_5(2X3F)
PANC_STAAR
[Raw transfer]




APC_A_6(1N2B)
PANC_MYCTU
[Raw transfer]




ATP_A_3(4G5Y)
PANC_MYCTU
[Raw transfer]




ATP_B_9(4G5Y)
PANC_MYCTU
[Raw transfer]




A7D_B_9(3IOE)
PANC_MYCTU
[Raw transfer]




ANP_A_3(3QTT)
PANC_FRATT
[Raw transfer]




APC_A_3(2X3F)
PANC_STAAR
[Raw transfer]




A7D_A_3(3IOE)
PANC_MYCTU
[Raw transfer]




AMP_A_2(3UY4)
PANC_CAMJE
[Raw transfer]




AMP_A_5(3Q10)
PANC_YERPE
[Raw transfer]




AMP_A_3(3UK2)
PANC_BURTA
[Raw transfer]




AMP_A_3(3UK2)
PANC_BURTA
[Raw transfer]




AMP_C_12(3Q10)
PANC_YERPE
[Raw transfer]




AMP_B_9(3Q10)
PANC_YERPE
[Raw transfer]




A6D_A_3(3IOD)
PANC_MYCTU
[Raw transfer]




A6D_B_9(3IOD)
PANC_MYCTU
[Raw transfer]




PAF_C_8(3Q12)
PANC_YERPE
[Raw transfer]




AMP_B_10(3UK2)
PANC_BURTA
[Raw transfer]




PAF_A_5(3Q12)
PANC_YERPE
[Raw transfer]




GOL_A_9(1UFV)
PANC_THET8
[Raw transfer]




GOL_A_9(1MOP)
PANC_MYCTU
[Raw transfer]




PAF_A_5(3Q12)
PANC_YERPE
[Raw transfer]




GOL_A_2(3MXT)
PANC_CAMJE
[Raw transfer]




PAF_B_7(3Q12)
PANC_YERPE
[Raw transfer]




GOL_A_3(3IVG)
PANC_MYCTU
[Raw transfer]




GOL_A_5(3MUE)
PANC_SALTY
[Raw transfer]




GOL_B_10(1V8F)
PANC_THET8
[Raw transfer]




GOL_C_22(3MUE)
PANC_SALTY
[Raw transfer]




AMP_A_5(3N8H)
PANC_FRATT
[Raw transfer]




GOL_A_6(3MXT)
PANC_CAMJE
[Raw transfer]




FMT_A_5(3MXT)
PANC_CAMJE
[Raw transfer]




AMP_A_5(3N8H)
PANC_FRATT
[Raw transfer]




A5D_A_5(3IOC)
PANC_MYCTU
[Raw transfer]




GOL_A_6(3MXT)
PANC_CAMJE
[Raw transfer]




A5D_B_6(3IOC)
PANC_MYCTU
[Raw transfer]




PAF_D_10(3Q12)
PANC_YERPE
[Raw transfer]




AMP_D_14(3Q10)
PANC_YERPE
[Raw transfer]




GOL_B_16(3MUE)
PANC_SALTY
[Raw transfer]




GOL_A_6(1UFV)
PANC_THET8
[Raw transfer]




A4D_A_3(3IOB)
PANC_MYCTU
[Raw transfer]




GOL_A_7(3COV)
PANC_MYCTU
[Raw transfer]




2DQ_A_7(4MUI)
PANC_MYCTO
[Raw transfer]




EDO_A_4(1IHO)
PANC_ECOLI
[Raw transfer]




FMT_A_9(3MXT)
PANC_CAMJE
[Raw transfer]




A4D_B_10(3IOB)
PANC_MYCTU
[Raw transfer]




EDO_B_5(1IHO)
PANC_ECOLI
[Raw transfer]




2DJ_A_5(4MUF)
PANC_MYCTO
[Raw transfer]




EDO_A_9(4FZJ)
PANC_MYCTU
[Raw transfer]




29W_A_6(4MQ6)
PANC_MYCTO
[Raw transfer]




2DQ_B_10(4MUI)
PANC_MYCTO
[Raw transfer]




2DV_A_3(4MUK)
PANC_MYCTO
[Raw transfer]




0JD_A_4(4G5F)
PANC_MYCTU
[Raw transfer]




15N_B_10(4G5F)
PANC_MYCTU
[Raw transfer]




2DU_A_6(4MUJ)
PANC_MYCTO
[Raw transfer]




0JD_B_8(4DE5)
PANC_MYCTU
[Raw transfer]




2DN_B_11(4MUH)
PANC_MYCTO
[Raw transfer]




2DU_B_11(4MUJ)
PANC_MYCTO
[Raw transfer]




0JD_A_3(4DE5)
PANC_MYCTU
[Raw transfer]




FG6_B_14(3IVX)
PANC_MYCTU
[Raw transfer]




2DW_B_13(4MUL)
PANC_MYCTO
[Raw transfer]




FG5_B_16(3IVG)
PANC_MYCTU
[Raw transfer]




BZ2_A_3(3IMG)
PANC_MYCTU
[Raw transfer]




BZ2_A_3(3IME)
PANC_MYCTU
[Raw transfer]




2DN_A_5(4MUH)
PANC_MYCTO
[Raw transfer]




2DJ_B_6(4MUF)
PANC_MYCTO
[Raw transfer]




2B5_B_11(3LE8)
PANC_MYCTU
[Raw transfer]




A8D_A_10(3ISJ)
PANC_MYCTU
[Raw transfer]




144_A_8(1V8F)
PANC_THET8
[Raw transfer]




2DK_A_7(4MUG)
PANC_MYCTO
[Raw transfer]




144_A_8(1V8F)
PANC_THET8
[Raw transfer]




29W_B_14(4MQ6)
PANC_MYCTO
[Raw transfer]




FG2_B_19(3IUB)
PANC_MYCTU
[Raw transfer]




FG4_B_11(3IVC)
PANC_MYCTU
[Raw transfer]




2DZ_B_15(4MUN)
PANC_MYCTO
[Raw transfer]




2DH_B_7(4MUE)
PANC_MYCTO
[Raw transfer]




2DV_B_12(4MUK)
PANC_MYCTO
[Raw transfer]




FG4_A_3(3IVC)
PANC_MYCTU
[Raw transfer]




2DK_B_11(4MUG)
PANC_MYCTO
[Raw transfer]




FG3_B_18(3IUE)
PANC_MYCTU
[Raw transfer]




BZ2_B_10(3IMG)
PANC_MYCTU
[Raw transfer]




2DZ_A_7(4MUN)
PANC_MYCTO
[Raw transfer]




BZ2_B_8(3IME)
PANC_MYCTU
[Raw transfer]




0HO_B_9(4DDM)
PANC_MYCTU
[Raw transfer]




0HO_A_8(4DDM)
PANC_MYCTU
[Raw transfer]




A8D_B_15(3ISJ)
PANC_MYCTU
[Raw transfer]




0HN_A_3(4DDK)
PANC_MYCTU
[Raw transfer]




0HN_B_7(4DDK)
PANC_MYCTU
[Raw transfer]




ACY_A_4(3AG6)
PANC_STAA8
[Raw transfer]




0W1_B_12(4FZJ)
PANC_MYCTU
[Raw transfer]




ACY_B_10(3AG6)
PANC_STAA8
[Raw transfer]




I2E_A_6(4EF6)
PANC_MYCTU
[Raw transfer]




I2E_B_17(4EF6)
PANC_MYCTU
[Raw transfer]




MS0_A_5(4DDH)
PANC_MYCTU
[Raw transfer]




0OC_A_3(4EFK)
PANC_MYCTU
[Raw transfer]




EOH_A_12(3MUE)
PANC_SALTY
[Raw transfer]




MS0_B_9(4DDH)
PANC_MYCTU
[Raw transfer]




0OC_B_10(4EFK)
PANC_MYCTU
[Raw transfer]




BZ3_A_3(3IMC)
PANC_MYCTU
[Raw transfer]




BZ3_B_11(3IMC)
PANC_MYCTU
[Raw transfer]




TRS_A_3(1IHO)
PANC_ECOLI
[Raw transfer]




FG6_A_4(3IVX)
PANC_MYCTU
[Raw transfer]




2DW_A_9(4MUL)
PANC_MYCTO
[Raw transfer]




2DH_A_4(4MUE)
PANC_MYCTO
[Raw transfer]




FG3_A_4(3IUE)
PANC_MYCTU
[Raw transfer]




FG2_A_11(3IUB)
PANC_MYCTU
[Raw transfer]




22 PsiBlast_CBE 96.5649%-105 - C5 -2X3F 8.6 PANC_STAAR
115 HHSearch 95.5446%-111 - C5 -2EJC - PANC_THEMA -
111 HHSearch 95.0249%-102 - C5 -3AG6 9.2 PANC_STAA8
3 PsiBlast_PDB 94.9849%-102 - C5 -2X3F 7.5 PANC_STAAR
4 PsiBlast_PDB 94.8246%-111 - C5 -2EJC - PANC_THEMA -
2 PsiBlast_PDB 94.4349% -99 - C5 -3AG6 9.2 PANC_STAA8
21 PsiBlast_CBE 93.4649% -98 - C5 -3AG6 9.2 PANC_STAA8
114 HHSearch 93.3443%-107 - C5 -3MXT 2.1 PANC_CAMJE
7 PsiBlast_PDB 92.7943%-102 - C5 -3UY4 6.7 PANC_CAMJE
1 PsiBlast_PDB 92.1149%-107 - C5 -3AG5 - PANC_STAA8 -
6 PsiBlast_PDB 91.6443%-102 - C5 -3MXT 3.4 PANC_CAMJE
12 PsiBlast_PDB 91.3839%-104 - C5 -1IHO 2.2 PANC_ECOLI
112 HHSearch 91.2541%-104 - C5 -3INN 7.4 PANC_BRUME
32 PsiBlast_CBE 91.1839%-105 - C5 -1IHO 2.5 PANC_ECOLI
101 Fugue 90.8138%-110 - C5 -1IHO 2.9 PANC_ECOLI
25 PsiBlast_CBE 89.8940% -94 - C5 -3INN 8.3 PANC_BRUME
9 PsiBlast_PDB 89.3740% -95 - C5 -3INN 7.4 PANC_BRUME
116 HHSearch 89.1439%-108 - C5 -3UK2 6.5 PANC_BURTA
14 PsiBlast_PDB 88.5238%-103 - C5 -3UK2 6.5 PANC_BURTA
36 PsiBlast_CBE 87.9438%-103 - C5 -3UK2 6.6 PANC_BURTA
119 HHSearch 87.4745%-100 - C5 -1V8F 1.7 PANC_THET8
34 PsiBlast_CBE 86.6838%-107 - C5 -3MUE 3.3 PANC_SALTY
118 HHSearch 86.6640%-102 - C5 -3Q12 2.8 PANC_YERPE
13 PsiBlast_PDB 86.4638%-107 - C5 -3MUE 3.3 PANC_SALTY
8 PsiBlast_PDB 86.4246% -91 - C5 -1UFV 2.5 PANC_THET8
24 PsiBlast_CBE 86.3640% -99 - C5 -3INN 7.6 PANC_BRUME
5 PsiBlast_PDB 85.0746% -91 - C5 -1V8F 1.7 PANC_THET8
26 PsiBlast_CBE 84.9139%-103 - C5 -3Q12 2.9 PANC_YERPE
23 PsiBlast_CBE 84.3346% -91 - C5 -1V8F 2.8 PANC_THET8
35 PsiBlast_CBE 83.9738%-101 - C5 -3MUE 2.5 PANC_SALTY
27 PsiBlast_CBE 83.4139% -91 - C5 -3Q12 2.7 PANC_YERPE
30 PsiBlast_CBE 83.1739% -98 - C5 -3Q10 6.0 PANC_YERPE
28 PsiBlast_CBE 82.4439% -96 - C5 -3Q12 3.0 PANC_YERPE
11 PsiBlast_PDB 82.2739% -91 - C5 -3Q12 2.8 PANC_YERPE
10 PsiBlast_PDB 82.2239% -92 - C5 -3Q10 6.5 PANC_YERPE
31 PsiBlast_CBE 82.1339% -91 - C5 -3Q10 6.5 PANC_YERPE
113 HHSearch 80.4334% -96 - C5 -3COV 2.5 PANC_MYCTU
17 PsiBlast_PDB 75.5442%-103 - C5 -4G5F 3.7 PANC_MYCTU
60 PsiBlast_CBE 75.1842%-103 - C5 -4FZJ 2.2 PANC_MYCTU
29 PsiBlast_CBE 75.0739%-115 - C5 -3Q10 5.3 PANC_YERPE
66 PsiBlast_CBE 74.9942%-102 - C5 -4DE5 3.9 PANC_MYCTU
70 PsiBlast_CBE 74.9842%-100 - C5 -4DDK 4.2 PANC_MYCTU
62 PsiBlast_CBE 74.9142%-104 - C5 -4EFK 3.2 PANC_MYCTU
94 PsiBlast_CBE 74.8842%-101 - C5 -3IOB 6.2 PANC_MYCTU
82 PsiBlast_CBE 74.6742%-100 - C5 -3IUE 3.5 PANC_MYCTU
100 PsiBlast_CBE 74.6542%-101 - C5 -3IMC 4.3 PANC_MYCTU
68 PsiBlast_CBE 74.4042% -97 - C5 -4DDM 2.9 PANC_MYCTU
96 PsiBlast_CBE 74.2942%-100 - C5 -3IMG 3.0 PANC_MYCTU
46 PsiBlast_CBE 74.2542%-102 - C5 -4MUJ 8.3 PANC_MYCTO
58 PsiBlast_CBE 74.2142%-101 - C5 -4G5Y 9.1 PANC_MYCTU
64 PsiBlast_CBE 74.1942%-101 - C5 -4EF6 4.8 PANC_MYCTU
88 PsiBlast_CBE 74.0942%-101 - C5 -3IOE 7.7 PANC_MYCTU
98 PsiBlast_CBE 74.0842%-100 * C5 *3IME 3.3 PANC_MYCTU
84 PsiBlast_CBE 74.0842%-102 - C5 -3IUB 2.7 PANC_MYCTU
52 PsiBlast_CBE 74.0342%-100 - C5 -4MUG 6.9 PANC_MYCTO
72 PsiBlast_CBE 74.0042% -98 - C5 -4DDH 4.6 PANC_MYCTU
76 PsiBlast_CBE 73.7842%-100 - C5 -3IVX 3.1 PANC_MYCTU
19 PsiBlast_PDB 73.7142% -98 - C5 -1MOP 2.9 PANC_MYCTU
18 PsiBlast_PDB 73.6442% -99 - C5 -4MQ6 7.9 PANC_MYCTO
50 PsiBlast_CBE 73.4942%-100 - C5 -4MUH 6.7 PANC_MYCTO
87 PsiBlast_CBE 73.4642%-104 - C5 -3IOE 7.8 PANC_MYCTU
78 PsiBlast_CBE 73.4442%-100 - C5 -3IVG 2.6 PANC_MYCTU
86 PsiBlast_CBE 73.4342% -98 - C5 -3ISJ 4.9 PANC_MYCTU
42 PsiBlast_CBE 73.4042% -99 - C5 -4MUL 3.7 PANC_MYCTO
117 HHSearch 73.1736% -81 - C5 -3N8H 6.4 PANC_FRATT
80 PsiBlast_CBE 72.9942%-101 - C5 -3IVC 6.9 PANC_MYCTU
90 PsiBlast_CBE 72.7442%-102 - C5 -3IOD 8.1 PANC_MYCTU
40 PsiBlast_CBE 72.6742% -99 - C5 -4MUN 4.8 PANC_MYCTO
20 PsiBlast_PDB 72.6442% -97 - C5 -1N2B 8.2 PANC_MYCTU
56 PsiBlast_CBE 72.2942%-110 - C5 -4MUE 4.1 PANC_MYCTO
83 PsiBlast_CBE 72.1642%-106 - C5 -3IUB 6.2 PANC_MYCTU
48 PsiBlast_CBE 72.1342%-108 - C5 -4MUI 7.6 PANC_MYCTO
54 PsiBlast_CBE 72.0242%-101 - C5 -4MUF 7.9 PANC_MYCTO
59 PsiBlast_CBE 71.9742%-108 - C5 -4FZJ 4.4 PANC_MYCTU
89 PsiBlast_CBE 71.7342%-110 - C5 -3IOD 9.8 PANC_MYCTU
69 PsiBlast_CBE 71.6942%-102 - C5 -4DDK 4.0 PANC_MYCTU
38 PsiBlast_CBE 71.5842%-111 - C5 -4G5F 3.7 PANC_MYCTU
53 PsiBlast_CBE 71.5442%-112 - C5 -4MUF 7.6 PANC_MYCTO
37 PsiBlast_CBE 71.4142%-113 - C5 -4MQ6 7.2 PANC_MYCTO
41 PsiBlast_CBE 71.4042%-116 - C5 -4MUL 7.7 PANC_MYCTO
81 PsiBlast_CBE 71.1642%-107 - C5 -3IUE 6.8 PANC_MYCTU
49 PsiBlast_CBE 71.1442%-110 - C5 -4MUH 6.1 PANC_MYCTO
95 PsiBlast_CBE 70.9942%-113 - C5 -3IMG 3.3 PANC_MYCTU
99 PsiBlast_CBE 70.9642%-105 - C5 -3IMC 4.2 PANC_MYCTU
51 PsiBlast_CBE 70.9442%-107 - C5 -4MUG 6.3 PANC_MYCTO
85 PsiBlast_CBE 70.8342%-107 - C5 -3ISJ 5.0 PANC_MYCTU
43 PsiBlast_CBE 70.7242%-112 - C5 -4MUK 9.0 PANC_MYCTO
47 PsiBlast_CBE 70.6642%-113 - C5 -4MUI 6.7 PANC_MYCTO
44 PsiBlast_CBE 70.5742%-112 - C5 -4MUK 8.2 PANC_MYCTO
79 PsiBlast_CBE 70.4142%-104 - C5 -3IVC 7.5 PANC_MYCTU
55 PsiBlast_CBE 70.1942%-104 - C5 -4MUE 7.5 PANC_MYCTO
45 PsiBlast_CBE 70.1442%-114 - C5 -4MUJ 7.9 PANC_MYCTO
67 PsiBlast_CBE 70.0642%-106 - C5 -4DDM 2.9 PANC_MYCTU
73 PsiBlast_CBE 70.0542%-106 - C5 -3LE8 8.2 PANC_MYCTU
75 PsiBlast_CBE 70.0242%-106 - C5 -3IVX 7.5 PANC_MYCTU