@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0335: (2015-11-30 )
MQLKDKNIFITGSSRGIGLAIAHQFAQLGANIVLNGRSEISEDLIAEFADYGVKVIAISGDVSSFEDANRMIKEAIASLGSVDVLVNNAGITNDKLMLKMTVEDFESVLKINLTGAFNMTQSVLKPMTKARQGAIINISSVVGLTGNVGQANYAASKAGLIGFTKSVAREVAARGIRVNAIAPGFIESDMTDVIPEKMQEAILAQIPMKRIGKGKEVAQVASFLAEQEYLTGQVIAIDGGMTMQ

Atome Classification :

(39 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAP_E_5(1EDO)
FABG1_BRANA
[Raw transfer]




NAP_C_6(4JRO)
?
[Raw transfer]




NAP_A_8(3RSH)
FABG_VIBCH
[Raw transfer]




NAD_A_5(2CFC)
HCDR_XANP2
[Raw transfer]




NAP_B_19(3RSH)
FABG_VIBCH
[Raw transfer]




NAP_B_5(4JRO)
?
[Raw transfer]




NDP_A_3(3SJ7)
?
[Raw transfer]




NAP_D_7(4JRO)
?
[Raw transfer]




NDP_B_6(3SJ7)
?
[Raw transfer]




NDP_B_16(4I08)
FABG_VIBCH
[Raw transfer]




NAP_B_14(1Q7B)
FABG_ECOLI
[Raw transfer]




NAP_A_13(1Q7B)
FABG_ECOLI
[Raw transfer]




NAP_D_16(1Q7B)
FABG_ECOLI
[Raw transfer]




NAP_C_15(1Q7B)
FABG_ECOLI
[Raw transfer]




NDP_B_6(4WK6)
?
[Raw transfer]




NDP_D_8(4WK6)
?
[Raw transfer]




CAA_B_7(4NBU)
?
[Raw transfer]




EDO_B_22(3RRO)
FABG_VIBCH
[Raw transfer]




EDO_A_11(3RRO)
FABG_VIBCH
[Raw transfer]




1PE_B_5(2PNF)
FABG_AQUAE
[Raw transfer]




EDO_B_21(3RRO)
FABG_VIBCH
[Raw transfer]




PEG_A_3(3OSU)
FABG_STAAM
[Raw transfer]




1PE_A_6(2PNF)
FABG_AQUAE
[Raw transfer]




PEG_B_17(3OSU)
FABG_STAAM
[Raw transfer]




PEG_A_6(3OSU)
FABG_STAAM
[Raw transfer]




PGE_A_8(3RRO)
FABG_VIBCH
[Raw transfer]




81 PsiBlast_CBE 86.7845%-102 - C1 -4BO0 - FABG_PSEAE -
86 PsiBlast_CBE 86.1645%-104 - C1 -4BNZ - FABG_PSEAE -
25 PsiBlast_CBE 86.1049% -92 - C1 -2PNF 2.0 FABG_AQUAE
58 PsiBlast_CBE 85.8045%-107 - C1 -4BO7 - FABG_PSEAE -
62 PsiBlast_CBE 85.5245%-106 - C1 -4BO6 - FABG_PSEAE -
101 PsiBlast_CBE 84.8745%-104 - C1 -4BNV - FABG_PSEAE -
87 PsiBlast_CBE 84.6345%-104 - C1 -4BNZ - FABG_PSEAE -
5 PsiBlast_PDB 84.5349% -91 - C1 -2P68 - FABG_AQUAE -
24 PsiBlast_CBE 84.4748% -87 - C1 -3SJ7 10.2 ?
97 PsiBlast_CBE 84.3945%-100 - C1 -4BNW - FABG_PSEAE -
92 PsiBlast_CBE 84.2945%-105 - C1 -4BNX - FABG_PSEAE -
91 PsiBlast_CBE 84.0645% -99 - C1 -4BNY - FABG_PSEAE -
74 PsiBlast_CBE 83.7345%-105 - C1 -4BO2 - FABG_PSEAE -
57 PsiBlast_CBE 83.6545%-102 - C1 -4BO7 - FABG_PSEAE -
71 PsiBlast_CBE 83.5045%-101 - C1 -4BO3 - FABG_PSEAE -
4 PsiBlast_PDB 83.2649% -91 - C1 -2PNF 2.2 FABG_AQUAE
54 PsiBlast_CBE 83.2145%-101 - C1 -4BO8 - FABG_PSEAE -
61 PsiBlast_CBE 83.0545% -96 - C1 -4BO6 - FABG_PSEAE -
59 PsiBlast_CBE 82.8545%-104 - C1 -4BO7 - FABG_PSEAE -
77 PsiBlast_CBE 82.7445%-104 - C1 -4BO2 - FABG_PSEAE -
22 PsiBlast_CBE 81.3750% -94 - C1 -4JRO 10.9 ?
12 PsiBlast_PDB 81.2646% -86 - C1 -3OSU 2.3 FABG_STAAM
21 PsiBlast_CBE 79.1950% -87 - C1 -4JRO 9.1 ?
17 PsiBlast_PDB 78.5647% -93 - C1 -1EDO 12.9 FABG1_BRANA
3 PsiBlast_PDB 77.6648% -86 - C1 -3SJ7 8.4 ?
23 PsiBlast_CBE 76.3150% -90 - C1 -4JRO 9.8 ?
46 PsiBlast_CBE 75.2345% -84 - C1 -4NBU 5.6 ?
26 PsiBlast_CBE 72.1346% -94 - C1 -4WK6 6.2 ?
31 PsiBlast_CBE 71.3946% -82 - C1 -4I08 11.3 FABG_VIBCH
32 PsiBlast_CBE 70.8846% -85 - C1 -3RSH 11.4 FABG_VIBCH
11 PsiBlast_PDB 70.6846% -82 - C1 -3RRO 2.9 FABG_VIBCH
10 PsiBlast_PDB 69.3946% -81 - C1 -3RSH 12.1 FABG_VIBCH
33 PsiBlast_CBE 69.2846% -82 - C1 -3RRO 3.0 FABG_VIBCH
28 PsiBlast_CBE 68.5946% -92 - C1 -4WK6 6.6 ?
48 PsiBlast_CBE 68.3145% -83 - C1 -1Q7B 9.0 FABG_ECOLI
50 PsiBlast_CBE 68.1345% -81 - C1 -1Q7B 9.1 FABG_ECOLI
47 PsiBlast_CBE 67.7645% -82 * C1 *1Q7B 8.6 FABG_ECOLI
49 PsiBlast_CBE 66.6945% -80 - C1 -1Q7B 9.9 FABG_ECOLI
106 HHSearch 64.4936% -82 - C1 -2CFC 9.3 HCDR_XANP2