@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0551: (2015-12-01 )
MANKQDLIAKVAEATELTKKDSAAAVDAVFAAVADYLAEGEKVQLIGFGNFEVRERAARKGRNPQTGAEIEIAASKVPAFKAGKALKDAVK

Atome Classification :

(31 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NACID_H_4(1P51)
DBH_NOSS1
[Raw transfer]

-

NACID_D_2(2IIE)

[Raw transfer]

-

NACID_D_2(1IHF)
IHFB_ECOLI
[Raw transfer]

-

NACID_I_3(1P51)
DBH_NOSS1
[Raw transfer]

-

NACID_D_2(1P78)
DBH_NOSS1
[Raw transfer]

-

NACID_C_3(4QJU)
DBH_STAAM
[Raw transfer]

-

NACID_D_4(4QJU)
DBH_STAAM
[Raw transfer]

-

NACID_D_2(2IIF)
IHFA_ECOLI
[Raw transfer]

-

NACID_D_2(1OWG)
IHFA_ECOLI
[Raw transfer]

-

NACID_D_2(1OWF)
IHFA_ECOLI
[Raw transfer]

-

NACID_D_2(2IIE)
IHFA_ECOLI
[Raw transfer]

-

NACID_F_2(1P51)
DBH_NOSS1
[Raw transfer]

-

NACID_D_2(1P71)
DBH_NOSS1
[Raw transfer]

-

NACID_E_3(2IIE)
IHFA_ECOLI
[Raw transfer]

-

NACID_D_4(4QJU)
DBH_STAAM
[Raw transfer]

-

NACID_I_3(1P51)
DBH_NOSS1
[Raw transfer]

-

NACID_D_2(1P78)
DBH_NOSS1
[Raw transfer]

-

NACID_E_3(2HT0)
IHFB_ECOLI
[Raw transfer]

-

NACID_D_2(1OWF)
IHFB_ECOLI
[Raw transfer]

-

NACID_D_2(1P71)
DBH_NOSS1
[Raw transfer]

-

NACID_D_2(1P71)
DBH_NOSS1
[Raw transfer]

-

1 PsiBlast_PDB 83.4477% -68 - C6 -4QJN - DBH_STAAM -
2 PsiBlast_PDB 81.5477% -58 - C6 -4QJU 6.3 DBH_STAAM
21 PsiBlast_CBE 78.6277% -50 - C6 -4QJU 7.2 DBH_STAAM
3 PsiBlast_PDB 78.2273% -54 - C6 -1HUE - DBH_GEOSE -
53 Fugue 77.7967% -61 * C6 *1HUU - DBH_GEOSE -
4 PsiBlast_PDB 73.3773% -60 - C6 -1HUU - DBH_GEOSE -
9 PsiBlast_PDB 72.7551% -54 - C6 -1RIY - DBH_THEMA -
5 PsiBlast_PDB 72.5664% -54 - C6 -3RHI - ? -
34 HHSearch 70.5752% -71 - C6 -1B8Z - DBH_THEMA -
8 PsiBlast_PDB 69.8652% -72 - C6 -1B8Z - DBH_THEMA -
6 PsiBlast_PDB 69.6459% -56 - C6 -2O97 - DBHB_ECOLI -
35 HHSearch 69.6258% -62 - C6 -1MUL - DBHA_ECOLI -
7 PsiBlast_PDB 68.7458% -62 - C6 -1MUL - DBHA_ECOLI -
33 HHSearch 67.5546% -43 - C6 -1P71 1128214396763122245304320.0 DBH_NOSS1
10 PsiBlast_PDB 66.7046% -43 - C6 -1P51 4.2 DBH_NOSS1
11 PsiBlast_PDB 66.5646% -45 - C6 -1P71 1128214396763122245304320.0 DBH_NOSS1
27 PsiBlast_CBE 66.3246% -40 - C6 -1P51 3.9 DBH_NOSS1
12 PsiBlast_PDB 66.0046% -42 - C6 -1P78 4.8 DBH_NOSS1
25 PsiBlast_CBE 65.9646% -40 - C6 -1P51 4.3 DBH_NOSS1
24 PsiBlast_CBE 65.9046% -42 - C6 -1P71 1128214396763122245304320.0 DBH_NOSS1
26 PsiBlast_CBE 65.8246% -42 - C6 -1P51 5.6 DBH_NOSS1
40 HHSearch 65.1336% -41 - C6 -2IIE 2.8 IHFA_ECOLI (first)
38 HHSearch 64.6736% -42 - C6 -1OWF 3.0 IHFA_ECOLI
36 HHSearch 64.3038% -51 - C6 -1OWF 3.4 IHFB_ECOLI
23 PsiBlast_CBE 64.1746% -47 - C6 -1P78 4.5 DBH_NOSS1
13 PsiBlast_PDB 60.0039% -52 - C6 -1IHF Error IHFB_ECOLI
15 PsiBlast_PDB 59.8439% -53 - C6 -2HT0 3.9 IHFB_ECOLI
18 PsiBlast_PDB 56.7442% -24 - C6 -2IIF 2.8 IHFA_ECOLI (first)
19 PsiBlast_PDB 55.8342% -33 - C6 -2IIE 6.4 IHFA_ECOLI (first)
29 PsiBlast_CBE 55.3643% -34 - C6 -1OWG 2.8 IHFA_ECOLI
41 HHSearch 33.9539% 10 - C6 -2IIE 3.8