@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu00370: (2016-06-01 )
MFMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQVTGEVSDDNLKLAGGKLVLSKEGAEQIISEIQNQLQNLK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_E_1(2K1N)
ABRB_BACSU
[Raw transfer]
-
1 PsiBlast_PDB 96.11100% 0 - C- -2K1N - ABRB_BACSU -
21 PsiBlast_CBE 89.79100%-138 - C1 -2K1N - ABRB_BACSU -
5 PsiBlast_PDB 87.22100%-128 - C1 -2RO4 - ABRB_BACSU -
4 PsiBlast_PDB 86.03100%-134 - C1 -1Z0R - ABRB_BACSU -
3 PsiBlast_PDB 85.24100%-127 - C1 -1YSF - ABRB_BACSU -
2 PsiBlast_PDB 83.35100%-127 - C1 -1YFB - ABRB_BACSU -
22 PsiBlast_CBE 82.98100%-120 - C1 -2K1N - ABRB_BACSU -
24 HHSearch 80.48100%-128 - C1 -1YFB - ABRB_BACSU -
23 PsiBlast_CBE 73.85100% -87 - C1 -2K1N 5.6 ABRB_BACSU
46 Fugue 72.8670%-118 - C1 -2RO3 - ABH_BACSU -
8 PsiBlast_PDB 72.8670%-118 - C1 -2RO3 - ABH_BACSU -
27 HHSearch 72.7068%-121 - C1 -2W1T - SP5T_BACSU -
7 PsiBlast_PDB 72.5070%-110 - C1 -2FY9 - ABH_BACSU -
9 PsiBlast_PDB 69.1068%-127 - C1 -2W1T - SP5T_BACSU -
48 Fugue 68.0926% -75 - C2 -3HA4 - ? -
10 PsiBlast_PDB 66.7968%-101 - C1 -2RO5 - SP5T_BACSU -
45 Fugue 62.4393% -42 * C2 *2MJG - ABRB_BACSU -
32 HHSearch 61.63100% -49 - C2 -2MJG - ABRB_BACSU -
6 PsiBlast_PDB 61.63100% -49 - C2 -2MJG - ABRB_BACSU -
17 PsiBlast_PDB 60.1129% -55 - C2 -3HA4 - ? -