@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu16410: (2016-06-25 )
MQMNRYDQAATLRAKMEKRERVLPMVYSQKAKTLAVISGKGGVGKSNITLNMALALQDKGKKVLLIDLDIGMGNIDILIGNSSSATIIDVLTDRKPLLQSLSVGPKGLRYISGGTGLDVMFQLDQRKWTFFANELSHALSQFDYVLFDMGAGLSKDQLPFILSAEDILIITTPEPTAIMDAYSAVKHLVLTENKLSMKVAVNRCRDQKEGLDAFARLSRTIHMFLDVQVQFAGSVSDDVIVSKAVVEQVPFFIKSPQAKASRSVRILADALFEREETRHKEDKQTFIEKLSSFLMRRA

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_A_3(4RZ3)
?
[Raw transfer]




ADP_B_4(4RZ3)
?
[Raw transfer]




ATP_A_6(4V02)
?
[Raw transfer]




ADP_A_3(4V03)
?
[Raw transfer]




ADP_B_5(4V03)
?
[Raw transfer]




ADP_B_4(4RZ3)
?
[Raw transfer]




ADP_A_3(4RZ3)
?
[Raw transfer]




ATP_B_6(3Q9L)
MIND_ECOLI
[Raw transfer]




1 PsiBlast_PDB 82.4841%-116 * C1 *4RZ2 - ? -
53 HHSearch 79.7842%-126 - C1 -4RZ3 3.3 ?
21 PsiBlast_CBE 78.6441%-125 - C1 -4RZ3 8.5 ?
2 PsiBlast_PDB 78.0741%-124 - C1 -4RZ3 8.4 ?
77 Fugue 60.9221%-110 - C1 -2NIP - NIFH1_AZOVI -
60 HHSearch 60.1528%-130 - C1 -4V03 - ? -
3 PsiBlast_PDB 58.3828%-121 - C1 -1HYQ - ? -
62 HHSearch 58.2422%-113 - C1 -3Q9L 2.2 MIND_ECOLI
54 HHSearch 58.2226%-125 - C1 -1HYQ - ? -
7 PsiBlast_PDB 57.7126%-107 - C1 -1G3R - ? -
61 HHSearch 57.6724%-111 - C1 -1G3Q - ? -
6 PsiBlast_PDB 57.6326%-104 - C1 -1G3Q - ? -
75 Fugue 57.0920%-129 - C1 -3EA0 - ? -
79 Fugue 55.8322%-143 - C1 -3K9G - ? -
8 PsiBlast_PDB 55.4324%-116 - C1 -1ION - ? -
56 HHSearch 54.8918%-128 - C1 -3EA0 - ? -
4 PsiBlast_PDB 54.7235%-112 - C1 -4V03 7.0 ?
5 PsiBlast_PDB 54.0135%-118 - C1 -4V02 6.8 ?
59 HHSearch 53.9121%-103 - C1 -4WZA - NIFH1_AZOVI -
19 PsiBlast_PDB 53.7223%-119 - C1 -2C8V - NIFH1_AZOVI -
22 PsiBlast_CBE 52.5235%-114 - C1 -4V03 6.6 ?