@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu30420: (2016-07-20 )
MIDVQHIDHSFTIGKKGRENEVPVLKDVSLSVAKGEIACIVGRSGSGKSTLLNLISGYISPTKGRIVINGTDVTGFNEKEWAQFRLDHFGFIFQSFQLIPGLTTYENVEMPLALKGIKPSERKQKVQDMLKRVGLENHAAHYPNELSGGQQQRVSIARALILNPSIILADEPTGSLDSETEHEVLELIQQLNRERGITFVIITHDDEVASIGHSKFQLHDGVLKGGITVEV

Atome Classification :

(53 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_3(3FVQ)
FBPC_NEIG1
[Raw transfer]




ATP_A_3(3FVQ)
FBPC_NEIG1
[Raw transfer]




ANP_J_5(3C41)
?
[Raw transfer]




AGS_B_6(3C4J)
?
[Raw transfer]




ATP_A_5(1B0U)
HISP_SALTY
[Raw transfer]




ATP_J_5(4YMV)
?
[Raw transfer]




ATP_B_6(1L2T)
Y796_METJA
[Raw transfer]




ATP_B_6(3FVQ)
FBPC_NEIG1
[Raw transfer]




ATP_J_5(4YMU)
?
[Raw transfer]




ATP_A_6(4YMV)
?
[Raw transfer]




AGS_A_4(3C4J)
?
[Raw transfer]




ANP_B_7(2ONJ)
Y1866_STAAM
[Raw transfer]




ADP_A_3(1F3O)
Y796_METJA
[Raw transfer]




ANP_A_8(2ONJ)
Y1866_STAAM
[Raw transfer]




ATP_A_7(4YMU)
?
[Raw transfer]




ADP_C_11(4HLU)
ECFA1_THEMA
[Raw transfer]




ANP_K_6(3C41)
?
[Raw transfer]




ADP_B_6(2HYD)
Y1866_STAAM
[Raw transfer]




ADP_A_5(2HYD)
Y1866_STAAM
[Raw transfer]




ADP_B_6(2Q0H)
?
[Raw transfer]




ADP_D_7(4HLU)
ECFA1_THEMA
[Raw transfer]




ADP_A_5(2Q0H)
?
[Raw transfer]




ADP_B_6(2OLJ)
?
[Raw transfer]




ADP_B_8(3TIF)
Y796_METJA
[Raw transfer]




AT4_D_8(2OLK)
?
[Raw transfer]




AT4_B_6(2OLK)
?
[Raw transfer]




ADP_A_2(4U00)
?
[Raw transfer]




ADP_A_5(2OLJ)
?
[Raw transfer]




AT4_A_5(2OLK)
?
[Raw transfer]




AT4_C_7(2OLK)
?
[Raw transfer]




ADP_C_12(1G9X)
LIVG_METJA
[Raw transfer]




ATP_C_3(1VCI)
?
[Raw transfer]




ADP_B_10(1G9X)
LIVG_METJA
[Raw transfer]




ADP_A_4(1G6H)
LIVG_METJA
[Raw transfer]




ADP_A_8(1G9X)
LIVG_METJA
[Raw transfer]




LMT_A_7(4MKI)
ECFA2_CALS4
[Raw transfer]




LMT_B_4(4MKI)
ECFA2_CALS4
[Raw transfer]




1 PsiBlast_PDB 85.6344% -27 - C1 -1L2T - Y796_METJA -
21 PsiBlast_CBE 84.2044% -30 - C1 -1L2T 5.3 Y796_METJA
122 HHSearch 82.9438%-132 - C1 -3TUI - METN_ECOLI -
22 PsiBlast_CBE 82.7343% -29 - C1 -3TIF 6.3 Y796_METJA
3 PsiBlast_PDB 82.0244% -25 * C1 *1F3O 5.2 Y796_METJA
2 PsiBlast_PDB 81.1843% -30 - C1 -3TIF - Y796_METJA -
8 PsiBlast_PDB 78.7038%-149 - C1 -3TUZ - METN_ECOLI -
4 PsiBlast_PDB 78.1843%-115 - C1 -2PCJ - LOLD_AQUAE -
5 PsiBlast_PDB 77.1143%-114 - C1 -2PCL - LOLD_AQUAE -
28 PsiBlast_CBE 75.2538%-139 - C1 -3TUI - METN_ECOLI -
104 Fugue 74.5638% -20 - C1 -3TUZ - METN_ECOLI -
7 PsiBlast_PDB 74.3338%-140 - C1 -3TUI - METN_ECOLI -
27 PsiBlast_CBE 74.2638%-147 - C1 -3TUI - METN_ECOLI -
24 PsiBlast_CBE 73.7138%-147 - C1 -3TUZ - METN_ECOLI -
25 PsiBlast_CBE 72.8038%-141 - C1 -3TUZ - METN_ECOLI -
29 PsiBlast_CBE 72.2638%-135 - C1 -3TUI - METN_ECOLI -
6 PsiBlast_PDB 70.5739%-139 - C1 -3DHW - METN_ECOLI -
13 PsiBlast_PDB 69.2242% -73 - C1 -4YMV 4.4 ?
118 HHSearch 68.8136%-108 - C1 -2IT1 - ? -
26 PsiBlast_CBE 68.6938%-136 - C1 -3TUZ - METN_ECOLI -
31 PsiBlast_CBE 68.2642% -72 - C1 -4YMU 4.6 ?
30 PsiBlast_CBE 67.7042% -72 - C1 -4YMV 3.7 ?
12 PsiBlast_PDB 67.5342% -70 - C1 -4YMU 5.1 ?
63 PsiBlast_CBE 62.6841% -16 - C1 -1B0U 4.3 HISP_SALTY
121 HHSearch 62.4534%-116 - C1 -3FVQ 7.0 FBPC_NEIG1
64 PsiBlast_CBE 61.1635%-129 - C1 -3FVQ 7.6 FBPC_NEIG1
65 PsiBlast_CBE 60.8235%-130 - C1 -3FVQ 7.0 FBPC_NEIG1
46 PsiBlast_CBE 60.7236% -84 - C1 -2OLK 6.1 ?
49 PsiBlast_CBE 59.9136% -81 - C1 -2OLK 5.9 ?
48 PsiBlast_CBE 59.3136% -87 - C1 -2OLK 6.0 ?
41 PsiBlast_CBE 59.1836% -76 - C1 -2Q0H 5.6 ?
38 PsiBlast_CBE 58.9236% -76 - C1 -3C4J 5.1 ?
19 PsiBlast_PDB 58.4336% -75 - C1 -3C41 6.3 ?
20 PsiBlast_PDB 58.2836% -85 - C1 -2OLJ 5.7 ?
17 PsiBlast_PDB 57.6841% -60 - C1 -4U00 4.5 ?
37 PsiBlast_CBE 57.0836% -79 - C1 -3C41 5.8 ?
47 PsiBlast_CBE 56.8136% -85 - C1 -2OLK 6.0 ?
40 PsiBlast_CBE 56.1336% -81 - C1 -2Q0H 5.9 ?
39 PsiBlast_CBE 55.4836% -79 - C1 -3C4J 6.7 ?
50 PsiBlast_CBE 52.4736% -79 - C1 -2OLJ 5.8 ?
60 PsiBlast_CBE 52.0633%-137 - C1 -1VCI 3.9 ?
99 PsiBlast_CBE 47.4935% -11 - C1 -1G9X 4.4 LIVG_METJA
101 PsiBlast_CBE 47.4635% -5 - C1 -1G6H 4.9 LIVG_METJA
97 PsiBlast_CBE 44.9332% -67 - C1 -2HYD 5.4 Y1866_STAAM
95 PsiBlast_CBE 44.9032% -67 - C1 -2ONJ 4.9 Y1866_STAAM
98 PsiBlast_CBE 44.4235% -3 - C1 -1G9X 3.0 LIVG_METJA
96 PsiBlast_CBE 44.4132% -68 - C1 -2HYD 5.4 Y1866_STAAM
100 PsiBlast_CBE 44.2135% -6 - C1 -1G9X 3.7 LIVG_METJA
90 PsiBlast_CBE 43.7732% -25 - C1 -4MKI 4.1 ECFA2_CALS4
94 PsiBlast_CBE 43.1732% -67 - C1 -2ONJ 4.8 Y1866_STAAM
91 PsiBlast_CBE 43.1432% -24 - C1 -4MKI 2.0 ECFA2_CALS4
93 PsiBlast_CBE 38.1433% -39 - C1 -4HLU 5.3 ECFA1_THEMA
92 PsiBlast_CBE 37.5633% -39 - C1 -4HLU 5.0 ECFA1_THEMA