@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv0536: (2016-04-23 )
MRVLLTGAAGFIGSRVDAALRAAGHDVVGVDALLPAAHGPNPVLPPGCQRVDVRDASALAPLLAGVDLVCHQAAMVGAGVNAADAPAYGGHNDFATTVLLAQMFAAGVRRLVLASSMVVYGQGRYDCPQHGPVDPLPRRRADLDNGVFEHRCPGCGEPVIWQLVDEDAPLRPRSLYAASKTAQEHYALAWSEASGGSVVALRYHNVYGPGMPRDTPYSGVAAIFRSAVEKGKPPKVFEDGGQMRDFVHVDDVAAANLAAVHLGEADRDGFTAVNVCSGRPISILQVATAICDARGGSMSPAITGHYRSGDVRHIVADPARAARVLGFRAAVDPGEGLREFAFAPLR

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_D_8(2P5U)
?
[Raw transfer]




NAD_A_2(2P5Y)
?
[Raw transfer]




NAD_A_5(2P5U)
?
[Raw transfer]




NAD_C_7(2P5U)
?
[Raw transfer]




NAD_B_6(2P5U)
?
[Raw transfer]




4 PsiBlast_PDB 93.7131%-103 - C1 -2P5Y 12.0 ?
21 PsiBlast_CBE 92.4131% -99 - C1 -2P5U 10.2 ?
23 PsiBlast_CBE 92.2031%-102 - C1 -2P5U 10.7 ?
22 PsiBlast_CBE 91.3731% -97 - C1 -2P5U 11.3 ?
3 PsiBlast_PDB 91.2631% -96 - C1 -2P5U 9.9 ?
55 Fugue 90.6628% -98 - C1 -1Z45 - GAL10_YEAST -
37 HHSearch 87.5130% -96 - C1 -1R6D - ? -
48 HHSearch 86.0429% -92 * C1 *4ZRM - ? -
43 HHSearch 83.5624% -96 - C1 -2HUN - ? -
16 PsiBlast_PDB 83.1726% -91 - C1 -3KO8 - ? -
29 HHSearch 82.0829% -90 - C1 -4WOK - ? -
18 PsiBlast_PDB 80.9028% -88 - C1 -4LIS - ? -
38 HHSearch 80.8830% -85 - C1 -3VPS - ? -
6 PsiBlast_PDB 80.2427% -88 - C1 -1SB9 - ? -
15 PsiBlast_PDB 80.1326% -92 - C1 -3ICP - ? -
1 PsiBlast_PDB 80.1127% -90 - C1 -4ZRM - ? -
5 PsiBlast_PDB 79.7927% -88 - C1 -1SB8 - ? -
10 PsiBlast_PDB 79.6726% -90 - C1 -3RUD - GNE_PLESH -
31 HHSearch 79.6122% -94 - C1 -4EGB - ? -
2 PsiBlast_PDB 78.8927% -88 - C1 -4ZRN - ? -