@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv0760c: (2016-04-25 )
MTQTTQSPALIASQSSWRCVQAHDREGWLALMADDVVIEDPIGKSVTNPDGSGIKGKEAVGAFFDTHIAANRLTVTCEETFPSSSPDEIAHILVLHSEFDGGFTSEVRGVFTYRVNKAGLITNMRGYWNLDMMTFGNQE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NCA_A_2(2A15)
?
[Raw transfer]



NCA_A_2(2A15)
?
[Raw transfer]



NCA_D_10(2Z77)
?
[Raw transfer]



LDA_A_6(2Z76)
?
[Raw transfer]



HE7_C_8(2Z77)
?
[Raw transfer]



HE7_A_9(2Z77)
?
[Raw transfer]



HE7_C_8(2Z77)
?
[Raw transfer]
24 PsiBlast_CBE 94.42100%-115 - C1 -2Z77 2.6 ?
2 PsiBlast_PDB 94.23100%-113 - C1 -2Z76 4.4 ?
22 PsiBlast_CBE 94.10100%-116 - C1 -2Z77 3.3 ?
4 PsiBlast_PDB 93.91100%-111 - C1 -2Z7A - ? -
26 HHSearch 93.14100%-112 - C1 -2A15 3.7 ?
1 PsiBlast_PDB 93.14100%-112 - C1 -2A15 3.7 ?
3 PsiBlast_PDB 93.10100%-113 - C1 -2Z77 4.5 ?
23 PsiBlast_CBE 93.03100%-108 - C1 -2Z77 6.7 ?
21 PsiBlast_CBE 92.92100%-112 - C1 -2Z7A - ? -
25 PsiBlast_CBE 91.49100%-109 - C1 -2Z76 - ? -
11 PsiBlast_PDB 61.0827%-115 - C1 -3NHX - SDIS_COMTE -
14 PsiBlast_PDB 59.9326%-110 - C1 -1QJG - SDIS_COMTE -
5 PsiBlast_PDB 59.9328%-111 - C1 -1OCV - SDIS_COMTE -
17 PsiBlast_PDB 59.1126%-113 - C1 -3MKI - SDIS_COMTE -
18 PsiBlast_PDB 58.9026%-110 - C1 -3NUV - SDIS_COMTE -
9 PsiBlast_PDB 58.7327%-111 - C1 -3M8C - SDIS_COMTE -
8 PsiBlast_PDB 58.4127%-114 - C1 -8CHO - SDIS_COMTE -
19 PsiBlast_PDB 58.2626%-110 - C1 -4L7K - SDIS_COMTE -
13 PsiBlast_PDB 58.2526%-113 - C1 -1OHP - SDIS_COMTE -
15 PsiBlast_PDB 57.3126%-114 - C1 -1OHS - SDIS_COMTE -