@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA1159: (2016-01-27 )
MADREVGTVKWFNDAKGYGFIQRDSGPDVFVHYRAIRGEGHRSLVEGQKVEFSVIQGQKGLQAEDVSKV

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TRS_A_7(1C9O)
CSPB_BACCL
[Raw transfer]




TRS_A_7(1C9O)
CSPB_BACCL
[Raw transfer]




NACID_U_3(3TS2)
LN28A_MOUSE
[Raw transfer]

-

29 PsiBlast_CBE 92.3741%-125 - C5 -4ALP - ? -
28 PsiBlast_CBE 92.3641%-124 - C5 -4ALP - ? -
37 PsiBlast_CBE 92.0941%-130 - C5 -4A75 - ? -
30 PsiBlast_CBE 91.8141%-130 - C5 -4A76 - ? -
36 PsiBlast_CBE 91.7341%-131 - C5 -4A75 - ? -
33 PsiBlast_CBE 91.6641%-132 - C5 -4A76 - ? -
35 PsiBlast_CBE 91.6141%-127 - C5 -4A75 - ? -
34 PsiBlast_CBE 90.6341%-124 - C5 -4A75 - ? -
72 Fugue 90.3655%-122 * C5 *1C9O 3.1 CSPB_BACCL
31 PsiBlast_CBE 89.8041%-128 - C5 -4A76 - ? -
39 PsiBlast_CBE 89.4341%-122 - C5 -3ULJ - ? -
7 PsiBlast_PDB 89.2258%-124 - C5 -1HZC - CSPB_BACCL -
27 PsiBlast_CBE 89.1341%-126 - C5 -4ALP - ? -
32 PsiBlast_CBE 88.9541%-128 - C5 -4A76 - ? -
55 HHSearch 88.6355%-123 - C5 -1C9O 3.1 CSPB_BACCL
6 PsiBlast_PDB 87.8658%-131 - C5 -1HZB - CSPB_BACCL -
5 PsiBlast_PDB 87.6157%-124 - C5 -1HZ9 - CSPB_BACCL -
3 PsiBlast_PDB 87.4557%-131 - C5 -1C9O - CSPB_BACCL -
17 PsiBlast_PDB 87.2552%-137 - C5 -2I5L - CSPB_BACSU -
1 PsiBlast_PDB 87.2358%-119 - C5 -1HZA - CSPB_BACCL -
67 HHSearch 82.7842% -90 - C5 -3TS2 12.0 LN28A_MOUSE