@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA4676: (2016-02-29 )
MSDLQQLFENNVRWAEAIKQEDPDFFAKLARQQTPEYLWIGCSDARVPANEIVGMLPGDLFVHRNVANVVLHTDLNCLSVIQFAVDVLKVKHILVTGHYGCGGVRASLHNDQLGLIDGWLRSIRDLAYEYREHLEQLPTEEERVDRLCELNVIQQVANVSHTSIVQNAWHRGQSLSVHGCIYGIKDGLWKNLNVTVSGLDQLPPQYRLSPLGGCC

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

AZM_B_9(3UCJ)
?
[Raw transfer]



EPE_A_19(1G5C)
?
[Raw transfer]



GOL_A_6(3UCJ)
?
[Raw transfer]



GOL_A_6(3UCJ)
?
[Raw transfer]
1 PsiBlast_PDB 97.18100%-158 - C6 -4RXY - ? -
80 PsiBlast_CBE 84.8448%-142 - C6 -4WAJ - CAN_HAEIN -
10 PsiBlast_PDB 84.2249%-136 - C6 -2A8D - CAN_HAEIN -
32 PsiBlast_CBE 84.1649%-137 - C6 -2A8C - CAN_HAEIN -
31 PsiBlast_CBE 84.0949%-140 - C6 -2A8D - CAN_HAEIN -
9 PsiBlast_PDB 84.0349%-137 - C6 -2A8C - CAN_HAEIN -
24 PsiBlast_CBE 84.0154%-139 - C6 -1T75 - CAN_ECOLI -
28 PsiBlast_CBE 83.9549%-136 - C6 -2A8D - CAN_HAEIN -
30 PsiBlast_CBE 83.9249%-139 - C6 -2A8D - CAN_HAEIN -
27 PsiBlast_CBE 83.8449%-137 - C6 -2A8D - CAN_HAEIN -
41 PsiBlast_CBE 83.8149%-139 - C6 -3MF3 - CAN_HAEIN -
3 PsiBlast_PDB 83.8054%-140 - C6 -1T75 - CAN_ECOLI -
40 PsiBlast_CBE 83.7749%-135 - C6 -3MF3 - CAN_HAEIN -
22 PsiBlast_CBE 83.7654%-137 - C6 -1T75 - CAN_ECOLI -
29 PsiBlast_CBE 83.5349%-138 - C6 -2A8D - CAN_HAEIN -
37 PsiBlast_CBE 83.5049%-136 - C6 -3MF3 - CAN_HAEIN -
35 PsiBlast_CBE 83.4849%-136 - C6 -2A8C - CAN_HAEIN -
11 PsiBlast_PDB 83.4149%-134 - C6 -3MF3 - CAN_HAEIN -
4 PsiBlast_PDB 83.4054%-136 - C6 -2ESF - CAN_ECOLI -
23 PsiBlast_CBE 83.3954%-139 - C6 -1T75 - CAN_ECOLI -
117 HHSearch 81.0042%-131 - C6 -3UCJ 2.1 ?
96 PsiBlast_CBE 80.7143%-138 - C6 -3UCJ 2.1 ?
95 PsiBlast_CBE 80.2143%-138 - C6 -3UCJ 3.7 ?