@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : I3U493: (2017-12-26 )
MQILGGNNMAFPQLDLKSEKGPKAVIKTNRGDITVQLFPELAPKTVQNFIELSKKGYYDGVIFHRVIPDFMIQGGDPTGTGMGGESIYGESFEDEFSRELFNLRGALSMANSGPNTNGSQFFIVNNTNVPANMLGQLEGAGFPSEIIEAYKGGGTPWLDFRHTVFGHVLEGMDTVDEIANVQRGPQDRPVHDVVIETIEISE

Atome Classification :

(93 SA) .........10....-....20..-......30........40........50..----------.---------------...-..60........70.......-.-80.......-------------------------.-------------------------90.....-...100..-.----.-....110.---......120.......130.......140.......150.......160.......170.-........180.---..-.-------.-..190.......200
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) MQILGGNNMAFPQLD-LKSEKGPK-AVIKTNRGDITVQLFPELAPKTVQNFIELS----------K---------------KGY-YDGVIFHRVIPDFMIQGGDPT-G-TGMGGESIY-------------------------G-------------------------ESFEDEF-SREL-FNL-R----G-ALSMANSG---PNTNGSQFFIVNNTNVPANMLGQLEGAGFPSEIIEAYKGGGTPWLDFRHTVFGHVLE--G-MDTVDEIANVQR---GP-Q-------D-RPVHDVVIETIEISE
220 HHSearch 90.3154% -37 - C8 - - 2A2N C:[13-176] ------------QAE-GPKRVSDS-AIIHTSMGDIHTKLFPVECPKTVENFCVHS----------R---------------NGY-YNGHTFHRIIKGFMIQTGDPT-G-TGMGGESIW-------------------------G-------------------------GEFEDEF-HSTLRHDR-P----Y-TLSMANAG---SNTNGSQFFITVVP---------------------------TPWLDNKHTVFGRVTK--G-MEVVQRISNVKV---NPKT-------D-KPYEDVSIINITVK-
217 HHSearch 88.2951% -40 - C8 - - 2X7K - PPIL1_HUMAN A:[5-165] --------------P-PDSWQPPN-VYLETSMGIIVLELYWKHAPKTCKNFAELA----------R---------------RGY-YNGTKFHRIIKDFMIQGGDPT-G-TGRGGASIY-------------------------G-------------------------KQFEDEL-HPDLKFTG-A----G-ILAMANAG---PDTNGSQFFVTLAP---------------------------TQWLDGKHTIFGRVCQ--G-IGMVNRVGMVET---NS-Q-------D-RPVDDVKIIKAYPS-
219 HHSearch 88.0151% -34 - C8 - - 2OK3 - PPIL3_HUMAN A:[1-156] ----------------------MS-VTLHTDVGDIKIEVFCERTPKTCENFLALC----------A---------------SNY-YNGCIFHRNIKGFMVQTGDPT-G-TGRGGNSIW-------------------------G-------------------------KKFEDEY-SEYLKHNV-R----G-VVSMANNG---PNTNGSQFFITYGK---------------------------QPHLDMKYTVFGKVID--G-LETLDELEKLPV---NEKT-------Y-RPLNDVHIKDITIHA
226 HHSearch 87.9951% -7 - C8 - - 1W74 - PPIA_MYCTU A:[12-182] -------------------LATAT-ATLHTNRGDIKIALFGNHAPKTVANFVGLA----------QGTKDYSTQNASGGPSGPF-YDGAVFHRVIQGFMIQGGDPT-G-TGRGGP----------------------------G-------------------------YKFADEF-HPELQFDK-P----Y-LLAMANAG---PGTNGSQFFITVGK---------------------------TPHLNRRHTIFGEVIDAES-QRVVEAISKTAT---DG-N-------D-RPTDPVVIESITIS-
1 PsiBlast_PDB 87.8448% -29 - C8 - - 2A2N PPWD1_HUMAN A:[13-175] ------------QAE-GPKRVSDS-AIIHTSMGDIHTKLFPVECPKTVENFCVHS----------R---------------NGY-YNGHTFHRIIKGFMIQTGDPT-G-TGMGGESIW-------------------------G-------------------------GEFEDEF-HSTL-RHD-R----PYTLSMANAG---SNTNGSQFFI---TVVP------------------------TPWLDNKHTVFGRVTK--G-MEVVQRISNVKV---NP-KT------D-KPYEDVSIINITV--
21 PsiBlast_CBE 87.7248% -37 - C8 - - 2A2N C:[12-175] -----------TQAE-GPKRVSDS-AIIHTSMGDIHTKLFPVECPKTVENFCVHS----------R---------------NGY-YNGHTFHRIIKGFMIQTGDPT-G-TGMGGESIW-------------------------G-------------------------GEFEDEF-HSTL-RHD-R----PYTLSMANAG---SNTNGSQFFI---TVVP------------------------TPWLDNKHTVFGRVTK--G-MEVVQRISNVKV---NP-KT------D-KPYEDVSIINITV--
224 HHSearch 86.3851% -39 - C8 - - 2FU0 - ? A:[5-159] ---------------------PKS-AIIYTTMGDIHISLFYKECKKTVQNFSVHS----------I---------------NGY-YNNCIFHRVIKHFMVQTGDPS-G-DGTGGESIW-------------------------G-------------------------NEFEDEF-FDHLNHSK-P----F-MVSMANCG---PNTNGSQFFITTVP---------------------------CPWLDFKHTVFGKVTQ--G-SKIVLDIEKVRT---DK-R-------D-KPLEDIKILNIKIN-
222 HHSearch 85.5649% -30 - C8 - - 1ZKC PPIL2_HUMAN A:[14-175] ----------------LVPRGSGY-VRLHTNKGDLNLELHCDLTPKTCENFIRLC----------K---------------KHY-YDGTIFHRSIRNFVIQGGDPT-G-TGTGGESYW-------------------------G-------------------------KPFKDEF-RPNLSHTG-R----G-ILSMANSG---PNSNRSQFFITFRS---------------------------CAYLDKKHTIFGRVVG--G-FDVLTAMENVES---DPKT-------D-RPKEEIRIDATTVFV
7 PsiBlast_PDB 85.3744% -41 - C8 - - 1XYH - PPIL3_HUMAN A:[3-154] -------------------------VTLHTDVGDIKIEVFCERTPKTCENFLALC----------A---------------SNY-YNGCIFHRNIKGFMVQTGDPT-G-TGRGGNSIW-------------------------G-------------------------KKFEDEY-SEYLKHNV-R----G-VVSMANNG---PNTNGSQFFITY---------------------------GKQPHLDMKYTVFGKVID--G-LETLDELEKLPV---NE-K-------TYRPLNDVHIKDITI--
8 PsiBlast_PDB 85.3644% -38 - C8 - - 2OK3 - PPIL3_HUMAN A:[3-154] -------------------------VTLHTDVGDIKIEVFCERTPKTCENFLALC----------A---------------SNY-YNGCIFHRNIKGFMVQTGDPT-G-TGRGGNSIW-------------------------G-------------------------KKFEDEY-SEYLKHNV-R----G-VVSMANNG---PNTNGSQFFITY---------------------------GKQPHLDMKYTVFGKVID--G-LETLDELEKLPV---NE-K-------TYRPLNDVHIKDITI--
225 HHSearch 85.2751% -44 - C8 - - 2K7N - PPIL1_HUMAN A:[5-165] --------------P-PDSWQPPN-VYLETSMGIIVLELYWKHAPKTCKNFAELA----------R---------------RGY-YNGTKFHRIIKDFMIQGGDPT-G-TGRGGASIY-------------------------G-------------------------KQFEDEL-HPDLKFTG-A----G-ILAMANAG---PDTNGSQFFVTLAP---------------------------TQWLDGKHTIFGRVCQ--G-IGMVNRVGMVET---NS-Q-------D-RPVDDVKIIKAYPS-
221 HHSearch 84.8048% -37 - C8 - - 2B71 - ? A:[33-191] ----------------KGHTERGY-ITIYTNLGDFEVELYWYHSPKTCLNFYTLC----------E---------------MGF-YDNTIFHRVIPNFVIQGGDPT-G-TGKGGKSIY-------------------------G-------------------------EYFEDEI-NKELKHTG-A----G-ILSMSNNG---PNTNSSQFFITLAP---------------------------LPHLDGKHTIFARVSK--N-MTCIENIASVQT---TA-T-------N-KPIFDLKILRTST--
230 HHSearch 84.3644% -22 - C8 - - 4R3E CWC27_HUMAN A:[9-170] ----------------QEPPTNGK-VLLKTTAGDIDIELWSKEAPKACRNFIQLC----------L---------------EAY-YDNTIFHRVVPGFIVQGGDPT-G-TGSGGESIY-------------------------G-------------------------APFKDEF-HSRLRFNR-R----G-LVAMANAG---SHDNGSQFFFTLGR---------------------------ADELNNKHTIFGKVTG--DTVYNMLRLSEVDI---DD-D-------E-RPHNPHKIKSCEVLF
228 HHSearch 83.8244% -26 - C8 - - 2POE ? A:[15-175] --------------------YFQG-VRIITNYGDLKFELFCSQCPKACKNFLALS----------A---------------SGY-YKNTIFHKNIKGFIIQGGDPT-G-TGKGGESIY-------------------------G-------------------------RYFDDEI-YPELKYDR-R----G-ILSMASKGAKKPNTNGSQFFITYSS---------------------------LPQLNGEYVIFGKLID--G-FETLNTLENCPS---DK-S-------H-KPIDEIIIKDIVIHS
6 PsiBlast_PDB 83.5543% -36 - C8 - - 2OJU - PPIL3_HUMAN A:[6-160] ---------------------GMS-VTLHTDVGDIKIEVFCERTPKTCENFLALC----------A---------------SNY-YNGCIFHRNIKGFMVQTGDPT-G-TGRGGNSIW-------------------------G-------------------------KKFEDEY-SEYLKHNV-R----G-VVSMANNG---PNTNGSQFFITY---------------------------GKQPHLDMKYTVFGKVID--G-LETLDELEKLPV---NE-K-------TYRPLNDVHIKDITI--
3 PsiBlast_PDB 83.3046% -52 - C8 - - 2X7K - PPIL1_HUMAN A:[8-159] ------------------SWQPPN-VYLETSMGIIVLELYWKHAPKTCKNFAELA----------R---------------RGY-YNGTKFHRIIKDFMIQGGDPT-G-TGRGGASIY-------------------------G-------------------------KQFEDEL-HPDLKFTG-A----G-ILAMANAG---PDTNGSQFFV---TLAP------------------------TQWLDGKHTIFGRVCQ--G-IGMVNRVGMVET---NS-Q-------D-RPVDDVKI-------
10 PsiBlast_PDB 82.4743% -50 - C8 - - 2B71 - ? A:[27-186] --------IAYYKMK-GHTERG-Y-ITIYTNLGDFEVELYWYHSPKTCLNFYTLC----------E---------------MGF-YDNTIFHRVIPNFVIQGGDPT-G-TGKGGKSIY-------------------------G-------------------------EYFEDEI-NKEL-KHTGA----G-ILSMSNNG---PNTNSSQFFIT---------LAPL------------------PHLDGKHTIFARVSK--N-MTCIENIASVQT---TA-T-------N-KPIFDLKI-------
229 HHSearch 81.8446% 34 - C8 - - 4R3F ? A:[9-199] ---------------NLEPQPTGA-VIIHTTQGDLKVELFAKQTPLTCRNFLQHS----------L---------------DGY-YDGTIFHRLVPGFIIQGGDPT-G-TGHGGESIY-------------------------DGGAFSGDLDPWPMDQRKGHNAGPMGVNFKDEF-HSRLKFNR-R----G-LLGMANEGA--PDTNGSQFFFTLGK---------------------------AEELNNKNTLFGRVAA--G-DTIYNLMKWGEAELIEG-T-------E-RPQYPVKITNIEILL
49 PsiBlast_CBE 81.6837% 20 - C8 - - 4R3F ? A:[9-197] --------------N-LEPQPTGA-VIIHTTQGDLKVELFAKQTPLTCRNFLQHS----------L---------------DGY-YDGTIFHRLVPGFIIQGGDPT-G-TGHGGESIYDGGAFSGDLDPWPMDQRKGHNAGPMG-------------------------VNFKDEFHSRLK-FNR-R----G-LLGMANEGA--PDTNGSQFFFT---------LGKAEE------------------LNNKNTLFGRVAA--G-----DTIYNLMK---WG-EAELIEGTE-RPQYPVKITNIEI--
9 PsiBlast_PDB 81.5346% -12 - C8 - - 2FU0 - ? A:[5-159] ----------------------PKSAIIYTTMGDIHISLFYKECKKTVQNFSVHS----------I---------------NGY-YNNCIFHRVIKHFMVQTGDPS-G-DGTGGESIW-------------------------G-------------------------NEFEDEF-FDHL-NHS-K----PFMVSMANCG---PNTNGSQFFI---TTVPC------------------------PWLDFKHTVFGKVTQ--G-SKIVLDIEKVRT---DK-R-------D-KPLEDIKILNIKIN-
25 PsiBlast_CBE 74.1247% 26 - C8 - - 3EOV ? B:[26-166] --------------------------------GRITIGLFGKDAPLTTENFRQLCTG--------E---------------HGFGYKDSIFHRVIQNFMIQGGDFT-NFDGTGGKSIY-------------------------G-------------------------EKFADE--NLNV-KHF-V----G-ALSMANAG---PNTNGSQFFI---TTAP------------------------TPWLDGRHVVFGKVLD--G-MDVVLRIEKTKT---NS-H-------D-RPVKPVKI-------
26 PsiBlast_CBE 73.0747% 17 - C8 - - 3EOV ? A:[26-166] --------------------------------GRITIGLFGKDAPLTTENFRQLCTG--------E---------------HGFGYKDSIFHRVIQNFMIQGGDFT-NFDGTGGKSIY-------------------------G-------------------------EKFADE--NLNV-KHF-V----G-ALSMANAG---PNTNGSQFFI---TTAP------------------------TPWLDGRHVVFGKVLD--G-MDVVLRIEKTKT---NS-H-------D-RPVKPVKI-------
40 PsiBlast_CBE 71.1541% 30 - C8 - - 1E8K CYP3_CAEEL A:[18-165] --------------------------------GRIVMELYDDVVPKTAGNFRALCTGENGIGKSGK---------------PLH-FKGSKFHRIIPNFMIQGGDFTRG-NGTGGESIY-------------------------G-------------------------EKFPDEN-FKEK-HTG-P----G-VLSMANAG---PNTNGSQFFLCTVK---------------------------TEWLDGKHVVFGRVVE--G-LDVVKAVES--N---GS-Q-------SGKPVKDCMI-------
39 PsiBlast_CBE 71.0241% 29 - C8 - - 2IGV CYP3_CAEEL A:[18-165] --------------------------------GRIVMELYDDVVPKTAGNFRALCTGENGIGKSGK---------------PLH-FKGSKFHRIIPNFMIQGGDFTRG-NGTGGESIY-------------------------G-------------------------EKFPDEN-FKEK-HTG-P----G-VLSMANAG---PNTNGSQFFLCTVK---------------------------TEWLDGKHVVFGRVVE--G-LDVVKAVES--N---GS-Q-------SGKPVKDCMI-------
41 PsiBlast_CBE 70.1541% 29 - C8 - - 1E3B CYP3_CAEEL A:[18-165] --------------------------------GRIVMELYDDVVPKTAGNFRALCTGENGIGKSGK---------------PLH-FKGSKFHRIIPNFMIQGGDFTRG-NGTGGESIY-------------------------G-------------------------EKFPDEN-FKEK-HTG-P----G-VLSMANAG---PNTNGSQFFLCTVK---------------------------TEWLDGKHVVFGRVVE--G-LDVVKAVES--N---GS-Q-------SGKPVKDCMI-------
38 PsiBlast_CBE 69.6841% 27 - C8 - - 2IGW CYP3_CAEEL A:[18-165] --------------------------------GRIVMELYDDVVPKTAGNFRALCTGENGIGKSGK---------------PLH-FKGSKFHRIIPNFMIQGGDFTRG-NGTGGESIY-------------------------G-------------------------EKFPDEN-FKEK-HTG-P----G-VLSMANAG---PNTNGSQFFLCTVK---------------------------TEWLDGKHVVFGRVVE--G-LDVVKAVES--N---GS-Q-------SGKPVKDCMI-------
45 PsiBlast_CBE 69.0144% 3 - C8 - - 1VDN CYPH_YEAST A:[16-143] --------------------------------GRVVFKLYNDIVPKTAENFRALCTG--------E---------------KGFGYAGSPFHRVIPDFMLQGGDFTAG-NGTGGKSIY-------------------------G-------------------------GKFPDEN-FKKH-HDR-P----G-LLSMANAG---PNTNGSQFFI---TTVPC------------------------PWLDGKHVVFGEVVD--G-YDIVKKVESL---------------------------------
56 PsiBlast_CBE 67.9446% -9 - C8 - - 2CFE ? A:[16-140] --------------------------------GTIKFKLFDDVVPKTAANFRALCTG--------E---------------KGFGYAGSHFHRVIPDFMLQGGDFTAG-NGTGGKSIY-------------------------G-------------------------AKFADEN-FQLK-HNK-P----G-LLSMANAG---PNTNGSQFFITTVV---------------------------TSWLDGKHVVFGEVID--G-MNVVKAI------------------------------------
66 PsiBlast_CBE 66.5344% 21 - C8 - - 4N1M PPIA_HUMAN A:[21-145] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
92 PsiBlast_CBE 65.8944% 25 - C8 - - 5NOZ ? A:[18-142] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
100 PsiBlast_CBE 65.6644% 23 - C8 - - 5NOR ? A:[18-142] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
96 PsiBlast_CBE 65.6044% 22 - C8 - - 5NOV ? A:[18-142] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
94 PsiBlast_CBE 65.3944% 29 - C8 - - 5NOX ? A:[18-142] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
71 PsiBlast_CBE 65.3544% 23 - C8 - - 5T9W PPIA_HUMAN A:[17-141] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
98 PsiBlast_CBE 65.3244% 27 - C8 - - 5NOT ? A:[18-142] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
179 PsiBlast_CBE 65.1044% 28 - C8 - - 3RDD PPIA_HUMAN A:[37-161] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
104 PsiBlast_CBE 64.7044% 28 - C8 - - 4N1R PPIA_HUMAN A:[18-142] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
99 PsiBlast_CBE 64.6544% 22 - C8 - - 5NOS ? A:[18-142] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
161 PsiBlast_CBE 64.6244% 24 - C8 - - 1NMK PPIA_HUMAN A:[18-142] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
95 PsiBlast_CBE 64.5544% 31 - C8 - - 5NOW ? A:[18-142] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
156 PsiBlast_CBE 64.3344% 27 - C8 - - 1W8L PPIA_HUMAN A:[18-142] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
102 PsiBlast_CBE 64.2844% 32 - C8 - - 5LUD PPIA_HUMAN A:[18-142] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
93 PsiBlast_CBE 64.1844% 29 - C8 - - 5NOY ? A:[18-142] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
160 PsiBlast_CBE 64.0144% 20 - C8 - - 1NMK PPIA_HUMAN B:[18-142] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
103 PsiBlast_CBE 63.9644% 23 - C8 - - 4N1S PPIA_HUMAN A:[18-142] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
70 PsiBlast_CBE 63.9344% 26 - C8 - - 5TA4 PPIA_HUMAN A:[17-141] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
154 PsiBlast_CBE 63.8844% 23 - C8 - - 1YND PPIA_HUMAN A:[18-142] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
101 PsiBlast_CBE 63.8144% 28 - C8 - - 5NOQ ? A:[18-142] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
107 PsiBlast_CBE 63.5444% 26 - C8 - - 4N1O PPIA_HUMAN A:[18-142] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
106 PsiBlast_CBE 63.5244% 29 - C8 - - 4N1P PPIA_HUMAN A:[18-142] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
108 PsiBlast_CBE 63.4644% 24 - C8 - - 4N1N PPIA_HUMAN A:[18-142] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
97 PsiBlast_CBE 63.4244% 25 - C8 - - 5NOU ? A:[18-142] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
67 PsiBlast_CBE 63.3244% 27 - C8 - - 5TA2 PPIA_HUMAN A:[17-141] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
105 PsiBlast_CBE 63.2844% 28 - C8 - - 4N1Q PPIA_HUMAN A:[18-142] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
64 PsiBlast_CBE 63.2744% 26 - C8 - - 5T9U PPIA_HUMAN B:[18-142] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
68 PsiBlast_CBE 62.9344% 23 - C8 - - 5T9Z PPIA_HUMAN A:[17-141] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
63 PsiBlast_CBE 62.9044% 25 - C8 - - 5T9U PPIA_HUMAN C:[18-142] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
203 PsiBlast_CBE 62.8644% 46 - C8 - - 4ZSD PPIF_HUMAN A:[17-141] --------------------------------GRVVLELKADVVPKTAENFRALCTG--------E---------------KGFGYKGSTFHRVIPSFMCQAGDFT-NHNGTGGKSIY-------------------------G-------------------------SRFPDE-----N-FTL-KHVGPG-VLSMANAG---PNTNGSQFFICTIK---------------------------TDWLDGKHVVFGHVIE--G-MDVVKKI------------------------------------
65 PsiBlast_CBE 62.5144% 27 - C8 - - 5T9U PPIA_HUMAN A:[18-142] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
215 PsiBlast_CBE 62.3844% 43 - C8 - - 5CBV PPIF_HUMAN A:[18-142] --------------------------------GRVVLELKADVVPKTAENFRALCTG--------E---------------KGFGYKGSTFHRVIPSFMCQAGDFT-NHNGTGGKSIY-------------------------G-------------------------SRFPDE-----N-FTL-KHVGPG-VLSMANAG---PNTNGSQFFICTIK---------------------------TDWLDGKHVVFGHVIE--G-MDVVKKI------------------------------------
186 PsiBlast_CBE 62.3544% 47 - C8 - - 3RDC PPIF_HUMAN A:[19-143] --------------------------------GRVVLELKADVVPKTAENFRALCTG--------E---------------KGFGYKGSTFHRVIPSFMCQAGDFT-NHNGTGGKSIY-------------------------G-------------------------SRFPDE-----N-FTL-KHVGPG-VLSMANAG---PNTNGSQFFICTIK---------------------------TDWLDGKHVVFGHVIE--G-MDVVKKI------------------------------------
155 PsiBlast_CBE 62.3444% 25 - C8 - - 1W8M PPIA_HUMAN A:[18-142] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
204 PsiBlast_CBE 62.2644% 46 - C8 - - 4ZSC PPIF_HUMAN A:[17-141] --------------------------------GRVVLELKADVVPKTAENFRALCTG--------E---------------KGFGYKGSTFHRVIPSFMCQAGDFT-NHNGTGGKSIY-------------------------G-------------------------SRFPDE-----N-FTL-KHVGPG-VLSMANAG---PNTNGSQFFICTIK---------------------------TDWLDGKHVVFGHVIE--G-MDVVKKI------------------------------------
193 PsiBlast_CBE 62.2544% 45 - C8 - - 3RCG PPIF_HUMAN A:[19-143] --------------------------------GRVVLELKADVVPKTAENFRALCTG--------E---------------KGFGYKGSTFHRVIPSFMCQAGDFT-NHNGTGGKSIY-------------------------G-------------------------SRFPDE-----N-FTL-KHVGPG-VLSMANAG---PNTNGSQFFICTIK---------------------------TDWLDGKHVVFGHVIE--G-MDVVKKI------------------------------------
197 PsiBlast_CBE 62.1644% 43 - C8 - - 3R56 PPIF_HUMAN A:[19-143] --------------------------------GRVVLELKADVVPKTAENFRALCTG--------E---------------KGFGYKGSTFHRVIPSFMCQAGDFT-NHNGTGGKSIY-------------------------G-------------------------SRFPDE-----N-FTL-KHVGPG-VLSMANAG---PNTNGSQFFICTIK---------------------------TDWLDGKHVVFGHVIE--G-MDVVKKI------------------------------------
201 PsiBlast_CBE 62.1444% 44 - C8 - - 5CCQ PPIF_HUMAN A:[17-141] --------------------------------GRVVLELKADVVPKTAENFRALCTG--------E---------------KGFGYKGSTFHRVIPSFMCQAGDFT-NHNGTGGKSIY-------------------------G-------------------------SRFPDE-----N-FTL-KHVGPG-VLSMANAG---PNTNGSQFFICTIK---------------------------TDWLDGKHVVFGHVIE--G-MDVVKKI------------------------------------
210 PsiBlast_CBE 62.1044% 43 - C8 - - 4J5A PPIF_HUMAN X:[17-141] --------------------------------GRVVLELKADVVPKTAENFRALCTG--------E---------------KGFGYKGSTFHRVIPSFMCQAGDFT-NHNGTGGKSIY-------------------------G-------------------------SRFPDE-----N-FTL-KHVGPG-VLSMANAG---PNTNGSQFFICTIK---------------------------TDWLDGKHVVFGHVIE--G-MDVVKKI------------------------------------
194 PsiBlast_CBE 61.9244% 46 - C8 - - 3RCF PPIF_HUMAN A:[19-143] --------------------------------GRVVLELKADVVPKTAENFRALCTG--------E---------------KGFGYKGSTFHRVIPSFMCQAGDFT-NHNGTGGKSIY-------------------------G-------------------------SRFPDE-----N-FTL-KHVGPG-VLSMANAG---PNTNGSQFFICTIK---------------------------TDWLDGKHVVFGHVIE--G-MDVVKKI------------------------------------
214 PsiBlast_CBE 61.8044% 46 - C8 - - 5CBW PPIF_HUMAN A:[18-142] --------------------------------GRVVLELKADVVPKTAENFRALCTG--------E---------------KGFGYKGSTFHRVIPSFMCQAGDFT-NHNGTGGKSIY-------------------------G-------------------------SRFPDE-----N-FTL-KHVGPG-VLSMANAG---PNTNGSQFFICTIK---------------------------TDWLDGKHVVFGHVIE--G-MDVVKKI------------------------------------
198 PsiBlast_CBE 61.7844% 44 - C8 - - 3R54 PPIF_HUMAN A:[19-143] --------------------------------GRVVLELKADVVPKTAENFRALCTG--------E---------------KGFGYKGSTFHRVIPSFMCQAGDFT-NHNGTGGKSIY-------------------------G-------------------------SRFPDE-----N-FTL-KHVGPG-VLSMANAG---PNTNGSQFFICTIK---------------------------TDWLDGKHVVFGHVIE--G-MDVVKKI------------------------------------
187 PsiBlast_CBE 61.7844% 48 - C8 - - 3RDB PPIF_HUMAN A:[19-143] --------------------------------GRVVLELKADVVPKTAENFRALCTG--------E---------------KGFGYKGSTFHRVIPSFMCQAGDFT-NHNGTGGKSIY-------------------------G-------------------------SRFPDE-----N-FTL-KHVGPG-VLSMANAG---PNTNGSQFFICTIK---------------------------TDWLDGKHVVFGHVIE--G-MDVVKKI------------------------------------
153 PsiBlast_CBE 61.7244% 29 - C8 - - 1YND PPIA_HUMAN B:[18-142] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
200 PsiBlast_CBE 61.6844% 44 - C8 - - 3R49 PPIF_HUMAN A:[19-143] --------------------------------GRVVLELKADVVPKTAENFRALCTG--------E---------------KGFGYKGSTFHRVIPSFMCQAGDFT-NHNGTGGKSIY-------------------------G-------------------------SRFPDE-----N-FTL-KHVGPG-VLSMANAG---PNTNGSQFFICTIK---------------------------TDWLDGKHVVFGHVIE--G-MDVVKKI------------------------------------
62 PsiBlast_CBE 61.6744% 28 - C8 - - 5T9U PPIA_HUMAN D:[18-142] --------------------------------GRVSFELFADKVPKTAENFRALSTG--------E---------------KGFGYKGSCFHRIIPGFMCQGGDFTRH-NGTGGKSIY-------------------------G-------------------------EKFEDEN-FILK-HTG-P----G-ILSMANAG---PNTNGSQFFICTAK---------------------------TEWLDGKHVVFGKVKE--G-MNIVEAM------------------------------------
207 PsiBlast_CBE 61.6044% 42 - C8 - - 4J5D PPIF_HUMAN X:[17-141] --------------------------------GRVVLELKADVVPKTAENFRALCTG--------E---------------KGFGYKGSTFHRVIPSFMCQAGDFT-NHNGTGGKSIY-------------------------G-------------------------SRFPDE-----N-FTL-KHVGPG-VLSMANAG---PNTNGSQFFICTIK---------------------------TDWLDGKHVVFGHVIE--G-MDVVKKI------------------------------------
212 PsiBlast_CBE 61.5944% 41 - C8 - - 4J58 PPIF_HUMAN A:[17-141] --------------------------------GRVVLELKADVVPKTAENFRALCTG--------E---------------KGFGYKGSTFHRVIPSFMCQAGDFT-NHNGTGGKSIY-------------------------G-------------------------SRFPDE-----N-FTL-KHVGPG-VLSMANAG---PNTNGSQFFICTIK---------------------------TDWLDGKHVVFGHVIE--G-MDVVKKI------------------------------------
191 PsiBlast_CBE 61.5544% 47 - C8 - - 3RCK PPIF_HUMAN X:[19-143] --------------------------------GRVVLELKADVVPKTAENFRALCTG--------E---------------KGFGYKGSTFHRVIPSFMCQAGDFT-NHNGTGGKSIY-------------------------G-------------------------SRFPDE-----N-FTL-KHVGPG-VLSMANAG---PNTNGSQFFICTIK---------------------------TDWLDGKHVVFGHVIE--G-MDVVKKI------------------------------------
195 PsiBlast_CBE 61.5144% 42 - C8 - - 3R59 PPIF_HUMAN A:[19-143] --------------------------------GRVVLELKADVVPKTAENFRALCTG--------E---------------KGFGYKGSTFHRVIPSFMCQAGDFT-NHNGTGGKSIY-------------------------G-------------------------SRFPDE-----N-FTL-KHVGPG-VLSMANAG---PNTNGSQFFICTIK---------------------------TDWLDGKHVVFGHVIE--G-MDVVKKI------------------------------------
185 PsiBlast_CBE 61.4444% 45 - C8 - - 2BIU PPIF_HUMAN X:[18-142] --------------------------------GRVVLELKADVVPKTAENFRALCTG--------E---------------KGFGYKGSTFHRVIPSFMCQAGDFT-NHNGTGGKSIY-------------------------G-------------------------SRFPDE-----N-FTL-KHVGPG-VLSMANAG---PNTNGSQFFICTIK---------------------------TDWLDGKHVVFGHVIE--G-MDVVKKI------------------------------------
184 PsiBlast_CBE 61.4444% 45 - C8 - - 4O8H PPIF_HUMAN A:[18-142] --------------------------------GRVVLELKADVVPKTAENFRALCTG--------E---------------KGFGYKGSTFHRVIPSFMCQAGDFT-NHNGTGGKSIY-------------------------G-------------------------SRFPDE-----N-FTL-KHVGPG-VLSMANAG---PNTNGSQFFICTIK---------------------------TDWLDGKHVVFGHVIE--G-MDVVKKI------------------------------------