@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : I3U493: (2017-12-26 )
MQILGGNNMAFPQLDLKSEKGPKAVIKTNRGDITVQLFPELAPKTVQNFIELSKKGYYDGVIFHRVIPDFMIQGGDPTGTGMGGESIYGESFEDEFSRELFNLRGALSMANSGPNTNGSQFFIVNNTNVPANMLGQLEGAGFPSEIIEAYKGGGTPWLDFRHTVFGHVLEGMDTVDEIANVQRGPQDRPVHDVVIETIEISE

Atome Classification :

(93 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

WM1_A_4(4N1P)
PPIA_HUMAN
[Raw transfer]




SFM_D_4(1NMK)
PPIA_HUMAN
[Raw transfer]




502_A_7(5CCQ)
PPIF_HUMAN
[Raw transfer]




SFM_D_4(1NMK)
PPIA_HUMAN
[Raw transfer]




4ZP_A_6(5CBV)
PPIF_HUMAN
[Raw transfer]




67Z_X_2(4J5A)
PPIF_HUMAN
[Raw transfer]




6B4_A_2(4J5B)
PPIF_HUMAN
[Raw transfer]




EA4_A_2(4XNC)
PPIF_HUMAN
[Raw transfer]




EA4_A_2(3RDC)
PPIF_HUMAN
[Raw transfer]




EA4_A_2(4ZSC)
PPIF_HUMAN
[Raw transfer]




EA4_A_2(3RDD)
PPIA_HUMAN
[Raw transfer]




671_A_2(4J59)
PPIF_HUMAN
[Raw transfer]




7B7_X_2(4J5E)
PPIF_HUMAN
[Raw transfer]




4ZT_A_8(5CCR)
PPIF_HUMAN
[Raw transfer]




4ZO_A_7(5CBW)
PPIF_HUMAN
[Raw transfer]




4ZM_A_6(5CBU)
PPIF_HUMAN
[Raw transfer]




7HG_B_6(5T9U)
PPIA_HUMAN
[Raw transfer]




7I6_X_2(4J5C)
PPIF_HUMAN
[Raw transfer]




53Z_A_2(4J58)
PPIF_HUMAN
[Raw transfer]




728_X_2(4J5D)
PPIF_HUMAN
[Raw transfer]




SFA_D_4(1YND)
PPIA_HUMAN
[Raw transfer]




78R_A_2(5T9Z)
PPIA_HUMAN
[Raw transfer]




78E_A_2(5T9W)
PPIA_HUMAN
[Raw transfer]




78X_A_2(5TA2)
PPIA_HUMAN
[Raw transfer]




7HG_D_8(5T9U)
PPIA_HUMAN
[Raw transfer]




4ZZ_A_7(5CCN)
PPIF_HUMAN
[Raw transfer]




7I6_A_2(4ZSD)
PPIF_HUMAN
[Raw transfer]




838_A_2(5TA4)
PPIA_HUMAN
[Raw transfer]




DMF_A_2(3RCG)
PPIF_HUMAN
[Raw transfer]




WM3_A_2(4N1R)
PPIA_HUMAN
[Raw transfer]




ALA_A_2(2CFE)
?
[Raw transfer]




WM2_A_2(4N1Q)
PPIA_HUMAN
[Raw transfer]




GLY_A_2(4N1M)
PPIA_HUMAN
[Raw transfer]




E1P_A_2(1W8M)
PPIA_HUMAN
[Raw transfer]




1P3_A_2(1W8L)
PPIA_HUMAN
[Raw transfer]




LSA_A_3(4N1O)
PPIA_HUMAN
[Raw transfer]




EOV_B_4(3EOV)
?
[Raw transfer]

-

UNU_A_2(4N1N)
PPIA_HUMAN
[Raw transfer]




ALA_B_2(1E8K)
CYP3_CAEEL
[Raw transfer]




EOV_A_3(3EOV)
?
[Raw transfer]

-

GLY_A_2(2IGW)
CYP3_CAEEL
[Raw transfer]




FMT_D_4(2POE)
?
[Raw transfer]




PEG_A_2(4O8H)
PPIF_HUMAN
[Raw transfer]




FP6_A_2(3R54)
PPIF_HUMAN
[Raw transfer]




GOL_A_4(4R3E)
CWC27_HUMAN
[Raw transfer]




76X_A_2(5LUD)
PPIA_HUMAN
[Raw transfer]




PRO_A_3(4N1M)
PPIA_HUMAN
[Raw transfer]




PRO_B_3(1E8K)
CYP3_CAEEL
[Raw transfer]




PRO_A_3(2IGW)
CYP3_CAEEL
[Raw transfer]




DMS_X_4(2BIU)
PPIF_HUMAN
[Raw transfer]




PRO_A_3(2CFE)
?
[Raw transfer]




MIO_X_3(3RDA)
PPIF_HUMAN
[Raw transfer]




M3I_X_4(3RCI)
PPIF_HUMAN
[Raw transfer]




WM1_A_3(4N1P)
PPIA_HUMAN
[Raw transfer]




6AI_A_3(3R56)
PPIF_HUMAN
[Raw transfer]




Q8A_A_2(3R49)
PPIF_HUMAN
[Raw transfer]




L60_A_2(5NOU)
?
[Raw transfer]




92Z_A_2(5NOS)
?
[Raw transfer]




93E_A_2(5NOQ)
?
[Raw transfer]




93K_A_2(5NOY)
?
[Raw transfer]




5MZ_A_3(3RDB)
PPIF_HUMAN
[Raw transfer]




93B_A_2(5NOV)
?
[Raw transfer]




SER_A_2(2IGV)
CYP3_CAEEL
[Raw transfer]




3AO_A_2(3R59)
PPIF_HUMAN
[Raw transfer]




5AO_A_2(3RCL)
PPIF_HUMAN
[Raw transfer]




ACE_B_3(1VDN)
CYPH_YEAST
[Raw transfer]




L89_A_2(5NOW)
?
[Raw transfer]




WM4_A_3(4N1S)
PPIA_HUMAN
[Raw transfer]




L99_A_2(5NOZ)
?
[Raw transfer]




L97_A_2(5NOX)
?
[Raw transfer]




N3M_A_5(3R57)
PPIF_HUMAN
[Raw transfer]




93Q_A_3(5NOR)
?
[Raw transfer]




938_A_3(5NOT)
?
[Raw transfer]




4SO_A_3(3R4G)
PPIF_HUMAN
[Raw transfer]




BS4_A_3(3RCF)
PPIF_HUMAN
[Raw transfer]




7HG_B_6(5T9U)
PPIA_HUMAN
[Raw transfer]




7HG_D_8(5T9U)
PPIA_HUMAN
[Raw transfer]




1FP_X_5(3RCK)
PPIF_HUMAN
[Raw transfer]




MIO_X_5(3RDA)
PPIF_HUMAN
[Raw transfer]




3EP_A_3(1E3B)
CYP3_CAEEL
[Raw transfer]




SFA_D_4(1YND)
PPIA_HUMAN
[Raw transfer]




DMS_X_5(2BIU)
PPIF_HUMAN
[Raw transfer]




220 HHSearch 90.3154% -37 - C8 -2A2N - -
217 HHSearch 88.2951% -40 - C8 -2X7K - PPIL1_HUMAN -
219 HHSearch 88.0151% -34 - C8 -2OK3 - PPIL3_HUMAN -
226 HHSearch 87.9951% -7 - C8 -1W74 - PPIA_MYCTU -
1 PsiBlast_PDB 87.8448% -29 - C8 -2A2N - PPWD1_HUMAN -
21 PsiBlast_CBE 87.7248% -37 - C8 -2A2N - -
224 HHSearch 86.3851% -39 - C8 -2FU0 - ? -
222 HHSearch 85.5649% -30 - C8 -1ZKC - PPIL2_HUMAN -
7 PsiBlast_PDB 85.3744% -41 - C8 -1XYH - PPIL3_HUMAN -
8 PsiBlast_PDB 85.3644% -38 - C8 -2OK3 - PPIL3_HUMAN -
225 HHSearch 85.2751% -44 - C8 -2K7N - PPIL1_HUMAN -
221 HHSearch 84.8048% -37 - C8 -2B71 - ? -
230 HHSearch 84.3644% -22 - C8 -4R3E 2.5 CWC27_HUMAN
228 HHSearch 83.8244% -26 - C8 -2POE 2.6 ?
6 PsiBlast_PDB 83.5543% -36 - C8 -2OJU - PPIL3_HUMAN -
3 PsiBlast_PDB 83.3046% -52 - C8 -2X7K - PPIL1_HUMAN -
10 PsiBlast_PDB 82.4743% -50 - C8 -2B71 - ? -
229 HHSearch 81.8446% 34 - C8 -4R3F - ? -
49 PsiBlast_CBE 81.6837% 20 - C8 -4R3F - ? -
9 PsiBlast_PDB 81.5346% -12 - C8 -2FU0 - ? -
25 PsiBlast_CBE 74.1247% 26 - C8 -3EOV 5.9 ?
26 PsiBlast_CBE 73.0747% 17 - C8 -3EOV 5.6 ?
40 PsiBlast_CBE 71.1541% 30 - C8 -1E8K 3.7 CYP3_CAEEL
39 PsiBlast_CBE 71.0241% 29 - C8 -2IGV 4.5 CYP3_CAEEL
41 PsiBlast_CBE 70.1541% 29 - C8 -1E3B 2.5 CYP3_CAEEL
38 PsiBlast_CBE 69.6841% 27 - C8 -2IGW 3.3 CYP3_CAEEL
45 PsiBlast_CBE 69.0144% 3 - C8 -1VDN 2.9 CYPH_YEAST
56 PsiBlast_CBE 67.9446% -9 - C8 -2CFE 3.4 ?
66 PsiBlast_CBE 66.5344% 21 - C8 -4N1M 3.3 PPIA_HUMAN
92 PsiBlast_CBE 65.8944% 25 - C8 -5NOZ 3.0 ?
100 PsiBlast_CBE 65.6644% 23 - C8 -5NOR 2.1 ?
96 PsiBlast_CBE 65.6044% 22 - C8 -5NOV 2.8 ?
94 PsiBlast_CBE 65.3944% 29 - C8 -5NOX 2.4 ?
71 PsiBlast_CBE 65.3544% 23 - C8 -5T9W 6.5 PPIA_HUMAN
98 PsiBlast_CBE 65.3244% 27 - C8 -5NOT 3.3 ?
179 PsiBlast_CBE 65.1044% 28 - C8 -3RDD 4.0 PPIA_HUMAN
104 PsiBlast_CBE 64.7044% 28 - C8 -4N1R 3.0 PPIA_HUMAN
99 PsiBlast_CBE 64.6544% 22 - C8 -5NOS 2.3 ?
161 PsiBlast_CBE 64.6244% 24 - C8 -1NMK Error PPIA_HUMAN
95 PsiBlast_CBE 64.5544% 31 - C8 -5NOW 2.8 ?
156 PsiBlast_CBE 64.3344% 27 - C8 -1W8L 3.4 PPIA_HUMAN
102 PsiBlast_CBE 64.2844% 32 - C8 -5LUD 2.5 PPIA_HUMAN
93 PsiBlast_CBE 64.1844% 29 - C8 -5NOY 2.2 ?
160 PsiBlast_CBE 64.0144% 20 - C8 -1NMK 8.3 PPIA_HUMAN
103 PsiBlast_CBE 63.9644% 23 - C8 -4N1S 3.2 PPIA_HUMAN
70 PsiBlast_CBE 63.9344% 26 - C8 -5TA4 7.0 PPIA_HUMAN
154 PsiBlast_CBE 63.8844% 23 - C8 -1YND 2.8 PPIA_HUMAN
101 PsiBlast_CBE 63.8144% 28 - C8 -5NOQ 3.0 ?
107 PsiBlast_CBE 63.5444% 26 - C8 -4N1O 3.2 PPIA_HUMAN
106 PsiBlast_CBE 63.5244% 29 - C8 -4N1P 2.8 PPIA_HUMAN
108 PsiBlast_CBE 63.4644% 24 - C8 -4N1N 3.1 PPIA_HUMAN
97 PsiBlast_CBE 63.4244% 25 - C8 -5NOU 2.4 ?
67 PsiBlast_CBE 63.3244% 27 - C8 -5TA2 7.4 PPIA_HUMAN
105 PsiBlast_CBE 63.2844% 28 - C8 -4N1Q 3.4 PPIA_HUMAN
64 PsiBlast_CBE 63.2744% 26 - C8 -5T9U 6.8 PPIA_HUMAN
68 PsiBlast_CBE 62.9344% 23 - C8 -5T9Z 7.1 PPIA_HUMAN
63 PsiBlast_CBE 62.9044% 25 - C8 -5T9U 3.9 PPIA_HUMAN
203 PsiBlast_CBE 62.8644% 46 - C8 -4ZSD 5.3 PPIF_HUMAN
65 PsiBlast_CBE 62.5144% 27 - C8 -5T9U 3.6 PPIA_HUMAN
215 PsiBlast_CBE 62.3844% 43 - C8 -5CBV 5.1 PPIF_HUMAN
186 PsiBlast_CBE 62.3544% 47 - C8 -3RDC 4.6 PPIF_HUMAN
155 PsiBlast_CBE 62.3444% 25 - C8 -1W8M 3.6 PPIA_HUMAN
204 PsiBlast_CBE 62.2644% 46 - C8 -4ZSC 4.5 PPIF_HUMAN
193 PsiBlast_CBE 62.2544% 45 - C8 -3RCG 2.0 PPIF_HUMAN
197 PsiBlast_CBE 62.1644% 43 - C8 -3R56 2.5 PPIF_HUMAN
201 PsiBlast_CBE 62.1444% 44 - C8 -5CCQ 4.1 PPIF_HUMAN
210 PsiBlast_CBE 62.1044% 43 - C8 -4J5A 7.0 PPIF_HUMAN
194 PsiBlast_CBE 61.9244% 46 - C8 -3RCF 2.9 PPIF_HUMAN
214 PsiBlast_CBE 61.8044% 46 - C8 -5CBW 4.8 PPIF_HUMAN
198 PsiBlast_CBE 61.7844% 44 - C8 -3R54 2.6 PPIF_HUMAN
187 PsiBlast_CBE 61.7844% 48 - C8 -3RDB 3.1 PPIF_HUMAN
153 PsiBlast_CBE 61.7244% 29 - C8 -1YND 11.7 PPIA_HUMAN
200 PsiBlast_CBE 61.6844% 44 - C8 -3R49 2.7 PPIF_HUMAN
62 PsiBlast_CBE 61.6744% 28 - C8 -5T9U 6.7 PPIA_HUMAN
207 PsiBlast_CBE 61.6044% 42 - C8 -4J5D 7.8 PPIF_HUMAN
212 PsiBlast_CBE 61.5944% 41 - C8 -4J58 5.2 PPIF_HUMAN
191 PsiBlast_CBE 61.5544% 47 - C8 -3RCK 2.4 PPIF_HUMAN
195 PsiBlast_CBE 61.5144% 42 - C8 -3R59 2.8 PPIF_HUMAN
185 PsiBlast_CBE 61.4444% 45 - C8 -2BIU 3.5 PPIF_HUMAN
184 PsiBlast_CBE 61.4444% 45 - C8 -4O8H 2.5 PPIF_HUMAN
199 PsiBlast_CBE 61.4244% 42 - C8 -3R4G 2.2 PPIF_HUMAN
209 PsiBlast_CBE 61.4044% 43 - C8 -4J5B 7.0 PPIF_HUMAN
192 PsiBlast_CBE 61.4044% 44 - C8 -3RCI 2.8 PPIF_HUMAN
202 PsiBlast_CBE 61.3444% 45 - C8 -5CCN 5.1 PPIF_HUMAN
205 PsiBlast_CBE 61.3344% 43 - C8 -4XNC 4.4 PPIF_HUMAN
196 PsiBlast_CBE 61.3144% 45 - C8 -3R57 2.8 PPIF_HUMAN
211 PsiBlast_CBE 61.3044% 43 - C8 -4J59 7.8 PPIF_HUMAN
213 PsiBlast_CBE 61.2744% 47 - C8 -5CCR 4.9 PPIF_HUMAN
216 PsiBlast_CBE 61.2644% 47 * C8 *5CBU 5.1 PPIF_HUMAN
208 PsiBlast_CBE 61.2444% 45 - C8 -4J5C 8.0 PPIF_HUMAN
190 PsiBlast_CBE 61.1344% 48 - C8 -3RCL 2.8 PPIF_HUMAN
188 PsiBlast_CBE 60.9144% 43 - C8 -3RDA 2.7 PPIF_HUMAN
206 PsiBlast_CBE 60.6744% 48 - C8 -4J5E 7.5 PPIF_HUMAN