@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu17680: (2016-06-28 )
MTQFDKQYNSIIKDIINNGISDEEFDVRTKWDSDGTPAHTLSVISKQMRFDNSEVPILTTKKVAWKTAIKELLWIWQLKSNDVNDLNMMGVHIWDQWKQEDGTIGHAYGFQLGKKNRSLNGEKVDQVDYLLHQLKNNPSSRRHITMLWNPDELDAMALTPCVYETQWYVKHGKLHLEVRARSNDMALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCHVYTRHIDNLKIQMEREQFEAPELWINPEVKDFYDFTIDDFKLINYKHGDKLLFEVAV

Atome Classification :

(58 SA) .........10........20..--------......30........40....-....50-.-..--.-.....60........70........80........90......------------...------------100------------------------------------------------.........110--.....------...---------------------------------120--.........130.......140.......150.......160.......170-----........180.......190.......200.......210.......220.......230.......240.......250----------....---....260.......270.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MTQFDKQYNSIIKDIINNGISDE--------EFDVRTKWDSDGTPAHTLSVIS-KQMRF--D-NS--E-VPILTTKKVAWKTAIKELLWIWQLKSNDVNDLNMMG-VHIWDQ------------WKQ------------E--------------------------------------------------DGTIGHAYGFQ---LGKKN------RSL---------------------------------N----GEKVDQVDYLLHQLKNNPSSRRHITMLWNPDELDAMALTPCVYETQWYVKH------GKLHLEVRARSNDMALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCHVYTRHIDNLKIQMEREQFEAPELWINPEV-----------KDFY---DFTIDDFKLINYKHGDKLLFEVAV
2 PsiBlast_PDB 99.04100% -90 - C8 -1BKO - TYSY1_BACSU A:[2-279] -TQFDKQYNSIIKDIINNGISDE--------EFDVRTKWDSDGTPAHTLSVIS-KQMRF--D-NS--E-VPILTTKKVAWKTAIKELLWIWQLKSNDVNDLNMMG-VHIWDQ------------WKQ------------E--------------------------------------------------DGTIGHAYGFQ---LGKKN------RSL---------------------------------N----GEKVDQVDYLLHQLKNNPSSRRHITMLWNPDELDAMALTPCVYETQWYVKH------GKLHLEVRARSNDMALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCHVYTRHIDNLKIQMEREQFEAPELWINPEV-----------KDFY---DFTIDDFKLINYKHGDKLLFEVAV
3 PsiBlast_PDB 98.94100% -93 - C- -1BKP - TYSY1_BACSU A:[2-279] -TQFDKQYNSIIKDIINNGISDE--------EFDVRTKWDSDGTPAHTLSVIS-KQMRF--D-NS--E-VPILTTKKVAWKTAIKELLWIWQLKSNDVNDLNMMG-VHIWDQ------------WKQ------------E--------------------------------------------------DGTIGHAYGFQ---LGKKN------RSL---------------------------------N----GEKVDQVDYLLHQLKNNPSSRRHITMLWNPDELDAMALTPCVYETQWYVKH------GKLHLEVRARSNDMALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCHVYTRHIDNLKIQMEREQFEAPELWINPEV-----------KDFY---DFTIDDFKLINYKHGDKLLFEVAV
21 PsiBlast_CBE 98.43100% -90 - C8 -1BSP TYSY1_BACSU B:[1-278] -TQFDKQYNSIIKDIINNGISDE--------EFDVRTKWDSDGTPAHTLSVIS-KQMRF--D-NS--E-VPILTTKKVAWKTAIKELLWIWQLKSNDVNDLNMMG-VHIWDQ------------WKQ------------E--------------------------------------------------DGTIGHAYGFQ---LGKKN------RSL---------------------------------N----GEKVDQVDYLLHQLKNNPSSRRHITMLWNPDELDAMALTPCVYETQWYVKH------GKLHLEVRARSNDMALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCHVYTRHIDNLKIQMEREQFEAPELWINPEV-----------KDFY---DFTIDDFKLINYKHGDKLLFEVAV
1 PsiBlast_PDB 97.41100% -87 - C8 -1B02 TYSY1_BACSU A:[1-279] MTQFDKQYNSIIKDIINNGISDE--------EFDVRTKWDSDGTPAHTLSVIS-KQMRF--D-NS--E-VPILTTKKVAWKTAIKELLWIWQLKSNDVNDLNMMG-VHIWDQ------------WKQ------------E--------------------------------------------------DGTIGHAYGFQ---LGKKN------RSL---------------------------------N----GEKVDQVDYLLHQLKNNPSSRRHITMLWNPDELDAMALTPCVYETQWYVKH------GKLHLEVRARSNDMALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCHVYTRHIDNLKIQMEREQFEAPELWINPEV-----------KDFY---DFTIDDFKLINYKHGDKLLFEVAV
5 PsiBlast_PDB 96.72100% -90 - C8 -1BSP TYSY1_BACSU A:[1-278] -TQFDKQYNSIIKDIINNGISD---------EFDVRTKWDSDGTPAHTLSVIS-KQMRF--D-NS--E-VPILTTKKVAWKTAIKELLWIWQLKSNDVNDLNMMG-VHIWDQ------------WKQ------------E--------------------------------------------------DGTIGHAYGFQ---LGKKN------RSL---------------------------------N----GEKVDQVDYLLHQLKNNPSSRRHITMLWNPDELDAMALTPCVYETQWYVKH------GKLHLEVRARSNDMALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCHVYTRHIDNLKIQMEREQFEAPELWINPEV-----------KDFY---DFTIDDFKLINYKHGDKLLFEVAV
4 PsiBlast_PDB 96.03100% -89 - C8 -1BSF - TYSY1_BACSU A:[2-279] -TQFDKQYNSIIKDIINNGISDE--------EFDVRTKWDSDGTPAHTLSVIS-KQMRF--D-NS--E-VPILTTKKVAWKTAIKELLWIWQLKSNDVNDLNMMG-VHIWDQ------------WKQ------------E--------------------------------------------------DGTIGHAYGFQ---LGKKN------RSL---------------------------------N----GEKVDQVDYLLHQLKNNPSSRRHITMLWNPDELDAMALTPCVYETQWYVKH------GKLHLEVRARSNDMALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCHVYTRHIDNLKIQMEREQFEAPELWINPEV-----------KDFY---DFTIDDFKLINYKHGDKLLFEVAV
101 HHSearch 77.8597% 11 - C- -1BKP - TYSY1_BACSU A:[2-279] -TQFDKQYNSIIKDIINNGISDEEFDVRTKWDSDGT-PA-----H--TLSVIS-KQMRF--D-NS--E-VPILTTKKVAWKTAIKELLWIWQLKSNDVNDLNMMG-VHIWDQ------------WKQ------------E--------------------------------------------------DGTIGHAYGFQ---LGKKN------RSL---------------------------------N----GEKVDQVDYLLHQLKNNPSSRRHITMLWNPDELDAMALTPCVYETQWYVKH------GKLHLEVRARSNDMALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCHVYTRHIDNLKIQMEREQFEAPELWINPEV-----------KDFY---DFTIDDFKLINYKHGDKLLFEVAV
122 Fugue 75.84100% -1 - C- -1BKP - TYSY1_BACSU A:[2-279] -TQFDKQYNSIIKDIINNGISDE--------EFDVRTKWDSDGTPAHTLSVIS-KQMRF--D-NS---EVPILTTKKVAWKTAIKELLWIWQLKSNDVNDLNMM-GVHIWDQWKQE--------------------------------------------------------------------------DGTIGHAYGFQ---LGKK-NRSLNG------------------------------------------EKVDQVDYLLHQLKNNPSSRRHITMLWNPDELDAMALTPCVYETQWYVKH------GKLHLEVRARSNDMALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCHVYTRHIDNLKIQMEREQFEAPELWINPEV-----------K---DFYDFTIDDFKLINYKHGDKLLFEVAV
6 PsiBlast_PDB 66.6338% -48 - C8 -3IX6 - TYSY_BRUME A:[2-251] -----RTYLDLLQHVLDHGVDRD------------------D----GTRSVFG-YQMRF--D-LE--EGFPVL---KLHLRSIIHELLWFLKGDTN-IAYLKENG-VTIWDE------------WAD------------E--------------------------------------------------NGDLGPVYGYQ---W-RSW------PAP---------------------------------D----GRHIDQIANLLKMLHTNPQSRRLIVSAWNPALVDEMALPPCHCLFQFYVAN------GRLSCQLYQRSADIFLGVPFNIASYALLTMMIAQVTGLKPGEFIHTLGDAHIYSNHFEQARLQLTRTPKKLPVMHINPDV-----------KDLF---AFRFEDFRLDG-------------
51 PsiBlast_CBE 66.3236% 3 - C8 -3OB7 TYSY_HUMAN A:[32-306] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY-----------------------------S----GQGVDQLQKVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPT-------
88 PsiBlast_CBE 66.1836% 3 - C8 -4H1I TYSY_HUMAN A:[32-306] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY-----------------------------S----GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPT-------
50 PsiBlast_CBE 66.1736% 5 - C8 -3OB7 TYSY_HUMAN B:[32-306] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY-----------------------------S----GQGVDQLQKVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPT-------
87 PsiBlast_CBE 66.0236% 6 - C8 -4H1I TYSY_HUMAN B:[32-306] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY-----------------------------S----GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPT-------
54 PsiBlast_CBE 65.9836% 5 - C8 -3HB8 TYSY_HUMAN C:[32-306] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY-----------------------------S----GQGVDQLQKVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPT-------
55 PsiBlast_CBE 65.9336% 4 - C8 -3HB8 TYSY_HUMAN B:[32-306] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY-----------------------------S----GQGVDQLQKVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPT-------
56 PsiBlast_CBE 65.8836% 2 - C8 -3HB8 TYSY_HUMAN A:[32-306] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY-----------------------------S----GQGVDQLQKVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPT-------
59 PsiBlast_CBE 65.7736% 4 - C8 -3H9K TYSY_HUMAN C:[32-306] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY-----------------------------S----GQGVDQLQKVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPT-------
83 PsiBlast_CBE 65.7536% 2 - C8 -5HS3 ? B:[8-289] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY-----------------------------S----GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPTIKMEMAV
65 PsiBlast_CBE 65.6036% 5 - C8 -2RDA TYSY_HUMAN C:[32-306] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY-----------------------------S----GQGVDQLQKVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPT-------
79 PsiBlast_CBE 65.5636% 3 - C8 -5HS3 ? F:[8-281] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY-----------------------------S----GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHP--------
69 PsiBlast_CBE 65.4536% 2 - C8 -1I00 TYSY_HUMAN A:[9-283] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY-----------------------------S----GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPT-------
42 PsiBlast_CBE 65.3636% 2 - C8 -1JU6 TYSY_HUMAN C:[32-313] ------QYLGQIQHILRCGVEKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY-----------------------------S----GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPTIKMEMAV
41 PsiBlast_CBE 65.1836% 4 - C8 -1JU6 TYSY_HUMAN D:[32-313] ------QYLGQIQHILRCGVEKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY-----------------------------S----GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPTIKMEMAV
20 PsiBlast_PDB 65.0836% 3 - C8 -2RD8 TYSY_HUMAN A:[32-308] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY-----------------------------S----GQGVDQLQKVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPTIK-----
35 PsiBlast_CBE 64.9736% 1 - C8 -3EJL TYSY_HUMAN D:[32-308] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY-----------------------------S----GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPTIK-----
43 PsiBlast_CBE 64.9636% 3 - C8 -1JU6 TYSY_HUMAN B:[32-313] ------QYLGQIQHILRCGVEKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY-----------------------------S----GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPTIKMEMAV
12 PsiBlast_PDB 64.6036% 4 - C8 -1JU6 TYSY_HUMAN A:[32-313] ------QYLGQIQHILRCGVEKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY-----------------------------S----GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPTIKMEMAV
38 PsiBlast_CBE 64.2736% 7 - C8 -1JUJ TYSY_HUMAN D:[32-313] ------QYLGQIQHILRCGVEKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY-----------------------------S----GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPTIKMEMAV
39 PsiBlast_CBE 64.1236% 7 - C8 -1JUJ TYSY_HUMAN C:[32-313] ------QYLGQIQHILRCGVEKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY-----------------------------S----GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPTIKMEMAV
40 PsiBlast_CBE 64.1136% 7 - C8 -1JUJ TYSY_HUMAN B:[32-313] ------QYLGQIQHILRCGVEKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY-----------------------------S----GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPTIKMEMAV
68 PsiBlast_CBE 64.0136% 9 - C8 -1I00 TYSY_HUMAN B:[9-283] ------QYLGQIQHILRCGVRKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY-----------------------------S----GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPT-------
9 PsiBlast_PDB 63.9735% 3 - C8 -4EB4 TYSY_MOUSE A:[26-307] ------QYLRQVEHILRCGFKKE------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VRIWDANGSRDFLDSLGFSAR------------Q--------------------------------------------------EGDLGPVYGFQWRHFGAEY------KDMDSDY-----------------------------S----GQGVDQLQKVIDTIKTNPDDRRIIMCAWNPKDLPLMALPPCHALCQFYVVN------GELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLQPGDFVHTLGDAHIYLNHIEPLKIQLQREPRPFPKLKILRKV-----------ETID---DFKVEDFQIEGYNPHPTIKMEMAV
13 PsiBlast_PDB 63.8736% 7 - C8 -1JUJ TYSY_HUMAN A:[32-313] ------QYLGQIQHILRCGVEKD------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VKIWDANGSRDFLDSLGFSTR------------E--------------------------------------------------EGDLGPVYGFQWRHFGAEY------RDMESDY-----------------------------S----GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVN------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------EKID---DFKAEDFQIEGYNPHPTIKMEMAV
95 PsiBlast_CBE 63.7336% 15 - C8 -5BY6 ? C:[19-303] VNQEELNYLNQLKDIIDHGVRK------------------NDRTGIGTLSTFG-TQSRYCLR-DD--I-FPLLTTKRVFWRGVVEELLWFIS-GSTNAKQLSEKN-VNIWDGNSSREFLDSRGLYNY------------E--------------------------------------------------EGDLGPVYGFQWRHFGCPY------SSM---------------------------------TADYKGKGYDQLQQCIKMIREEPESRRIIMTAWNPCDLEKVALPPCHCFVQFYVAD------GELSCQMYQRSADMGLGVPFNIASYSLLTRMIAHITSLKPGFFIHTIGDAHVYLTHVDALKVQMERKPRPFPKLKILRNV-----------ENID---DFRAEDFELINYKPYPKISM----
108 HHSearch 63.5036% 2 - C8 -1F28 TYSY_PNECA A:[3-297] -NAEEQQYLNLVQYIINHGEDRP----------DRT-GT-----G--TLSVFAPSPLKF--S-LRNKT-FPLLTTKRVFIRGVIEELLWFIRGET-DSLKLREKN-IHIWDA------------NGSREYLDSIGLTKRQ--------------------------------------------------EGDLGPIYGFQ---WRHFG------AEYIDCKTNY--------------------------I----GQGVDQLANIIQKIRTSPYDRRLILSAWNPADLEKMALPPCHMFCQFYVHIPSNNHRPELSCQLYQRSCDMGLGVPFNIASYALLTCMIAHVCDLDPGDFIHVMGDCHIYKDHIEALQQQLTRSPRPFPTLSLNRSI-----------TDIE---DFTLDDFNIQNYHPYETIKMKMSI
115 HHSearch 63.3931% -7 - C8 -3V8H ? A:[5-318] ----MKQYLDLVRTILDTGTWQS----------N---GI-----R--TIGIPG-AMLRF--D-LQQ-G-FPAVTTKKLAFKSAIGELVGFLRATR-SAAEFRALG-CKVWDA------------NAN------------ENAQWLANPYRRG--------------------------------------ADDLGDVYGVQ---WRRWP------GYKVLDAHADAQIADATSRGFRIVARFEEGGADKVLL----HKAIDQLRDCLDTIVRDPSSRRILFHGWNPAVLDEIALPACHLLYQFLPNVER----REISLCLYIRSNDVGLGTPFNLAEGAALLTLVGRLTGYSPRWFTYFIGDAHIYENQLDMLKQQLEREPFESPRLELAERVPDYAKTGKYEPQWLE---RVEPSDFTLVGYRHH---------
77 PsiBlast_CBE 63.3735% 7 - C8 -1RTS TYSY_RAT B:[26-303] ------QYLRQVEHIMRCGFKKE------------------DRTGTGTLSVFG-MQARY--SLRD--E-FPLLTTKRVFWKGVLEELLWFIK-GSTNAKELSSKG-VRIWDANGSRDFLDSLGFSAR------------Q--------------------------------------------------EGDLGPVYGFQWRHFGADY------KDMDSDY-----------------------------S----GQGVDQLQKVIDTIKTNPDDRRIIMCAWNPKDLPLMALPPCHALCQFYVVN------GELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLQPGDFVHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKV-----------ETID---DFKVEDFQIEGYNPHPTIKM----