@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu23360: (2016-07-06 )
MKTGYFLLEDGNKIEFELYPEAAPGTVANFEKLANEGFYDGLTFHRVIPGFVSQGGCPHGTGTGGPGYTIKCETEGNPHTHEAGALSMAHAGKDTGGSQFFIVHEPQPHLNGVHTVFGKVTSGLEFAKNMSNGDVMKEVRVEG

Atome Classification :

(105 SA) .........10........20........30....---------------...--------.40........50.....-...60-.....----------------------------.-..70........80-.--.-..--....90-.---.......100.......110-----.......120.-.-.....130---.........140.
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKTGYFLLEDGNKIEFELYPEAAPGTVANFEKLAN---------------EGF--------YDGLTFHRVIPGFVSQGG-CPHGT-GTGGP----------------------------G-YTIKCETEGNPHTH-E--A-GA--LSMAHA-G---KDTGGSQFFIVHEPQPHLNG-----VHTVFGKVTSG-L-EFAKNM-----SNGDVMKEVRVEG
1 PsiBlast_PDB 96.2975% -77 - C5 -2MVZ - ? A:[3-142] -KKGYILMENGGKIEFELFPNEAPVTVANFEKLAN---------------EGF--------YNGLTFHRVIPGFVSQGG-CPRGN-GTGDA----------------------------G-YTIPCETDNNPHRH-V--T-GA--MSMAHR-G---RDTGSCQFFIVHEPQPHLDG-----VHTVFGQVTSG-M-DVVRTM-----KNGDVMKEVKV--
101 HHSearch 91.2074% -43 - C5 -2MVZ - ? A:[3-144] -KKGYILMENGGKIEFELFPNEAPVTVANFEKLAN---------------EGF--------YNGLTFHRVIPGFVSQGG-CPRGN-GTGDA----------------------------G-YTIPCETDNNPHRH-V--T-GA--MSMAHR-G---RDTGSCQFFIVHEPQPHLDG-----VHTVFGQVTS--GMDVVRTM-----KNGDVMKEVKVFD
115 HHSearch 71.2644% -15 - C5 -1W74 - PPIA_MYCTU A:[15-163] --ATATLHTNRGDIKIALFGNHAPKTVANFVGLAQGTKDYSTQNASGGPSGPF--------YDGAVFHRVIQGFMIQGG-DPTGT-GRGGP----------------------------G-YKFADEFHPELQFD-K--P-YL--LAMANA-G---PGTNGSQFFITVGKTPHLNR-----RHTIFGEVIDAESQRVVEAI-----SKTA---------
109 HHSearch 70.8242% -33 - C5 -2A2N PPWD1_HUMAN A:[23-157] ---SAIIHTSMGDIHTKLFPVECPKTVENFCVHSR---------------NGY--------YNGHTFHRIIKGFMIQTG-DPTGT-GMGGESIW-------------------------G-GEFEDEFHSTLRHD-R--P-YT--LSMANA-G---SNTNGSQFFITVVPTPWLDN-----KHTVFGRVTK--GMEVVQRI-----SNVKV--------
111 HHSearch 69.0539% -8 - C5 -2HQ6 CWC27_HUMAN A:[25-160] --GKVLLKTTAGDIDIELWSKEAPKACRNFIQLCL---------------EAY--------YDNTIFHRVVPGFIVQGG-DPTGT-GSGGESIY-------------------------G-APFKDEFHSRLRFN-R--R-GL--VAMANA-G---SHDNGSQFFFTLGRADELNN-----KHTIFGKVTGD-TVYNMLRL-----SEVD---------
106 HHSearch 68.2537% -5 - C5 -2POE ? A:[17-155] --QGVRIITNYGDLKFELFCSQCPKACKNFLALSA---------------SGY--------YKNTIFHKNIKGFIIQGG-DPTGT-GKGGESIY-------------------------G-RYFDDEIYPELKYD-R--R-GI--LSMASK-GAKKPNTNGSQFFITYSSLPQLNG-----EYVIFGKLID--GFETLNTL-----ENCP---------
104 HHSearch 67.4135% -35 - C5 -2FU0 - ? A:[5-140] -PKSAIIYTTMGDIHISLFYKECKKTVQNFSVHSI---------------NGY--------YNNCIFHRVIKHFMVQTG-DPSGD-GTGGESIW-------------------------G-NEFEDEFFDHLNHS-K--P-FM--VSMANC-G---PNTNGSQFFITTVPCPWLDF-----KHTVFGKVTQ--GSKIVLDI-----EKVR---------
21 PsiBlast_CBE 67.2444% -31 - C5 -2A2N C:[33-157] -------------IHTKLFPVECPKTVENFCVHSR---------------NGY--------YNGHTFHRIIKGFMIQTG-DPTGT-GMGGESIW-------------------------G-GEFEDEFHSTLRHD-R--P-YT--LSMANA-G---SNTNGSQFFITVVPTPWLDN-----KHTVFGRVTKG-M-EVVQRI-----SNVKV--------
108 HHSearch 67.1241% -14 - C5 -2B71 ? A:[39-173] --GYITIYTNLGDFEVELYWYHSPKTCLNFYTLCE---------------MGF--------YDNTIFHRVIPNFVIQGG-DPTGT-GKGGKSIY-------------------------G-EYFEDEINKELKHT-G--A-GI--LSMSNN-G---PNTNSSQFFITLAPLPHLDG-----KHTIFARVSK--NMTCIENI-----ASVQ---------
116 HHSearch 66.9737% -7 - C5 -1V9T - PPIA_ECOLI A:[5-143] --PHVLLTTSAGNIELELDKQKAPVSVQNFVDYVN---------------SGF--------YNNTTFHRVIPGFMIQGG-GFTEQMQQKKP----------------------------N-PPIKNEADN-GLRN-T--R-GT--IAMARTAD---KDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVK--GMDVADKI-----SQVPT--------
6 PsiBlast_PDB 66.8544% -30 - C5 -2A2N PPWD1_HUMAN A:[33-157] -------------IHTKLFPVECPKTVENFCVHSR---------------NGY--------YNGHTFHRIIKGFMIQTG-DPTGT-GMGGESIW-------------------------G-GEFEDEFHSTLRHD-R--P-YT--LSMANA-G---SNTNGSQFFITVVPTPWLDN-----KHTVFGRVTKG-M-EVVQRI-----SNVKV--------
117 HHSearch 66.8040% -10 - C5 -2OK3 PPIL3_HUMAN A:[2-136] ---SVTLHTDVGDIKIEVFCERTPKTCENFLALCA---------------SNY--------YNGCIFHRNIKGFMVQTG-DPTGT-GRGGNSIW-------------------------G-KKFEDEYSEYLKHN-V--R-GV--VSMANN-G---PNTNGSQFFITYGKQPHLDM-----KYTVFGKVID--GLETLDEL-----EKLPV--------
2 PsiBlast_PDB 66.7546% -22 - C5 -2B71 ? A:[51-171] --------------EVELYWYHSPKTCLNFYTLCE---------------MGF--------YDNTIFHRVIPNFVIQGG-DPTGT-GKGGK----------------------------SIYGEYFEDEINKELK-H--T-GAGILSMSNN-G---PNTNSSQFFITLAPLPHLDG-----KHTIFARVSKN-M-TCIENI-----AS-----------
9 PsiBlast_PDB 66.7144% -11 - C5 -1XYH - PPIL3_HUMAN A:[5-126] ------LHTDVGDIKIEVFCERTPKTCENFLALCA---------------SNY--------YNGCIFHRNIKGFMVQTG-DPTGT-GRGGN----------------------------SIWGKKFEDEYSEYLK-HNVR-GV--VSMANN-G---PNTNGSQFFITYGKQPHLDM-----KYTVFGKVIDG-L-E-----------------------
103 HHSearch 66.6440% -28 - C5 -2X7K PPIL1_HUMAN A:[12-146] --PNVYLETSMGIIVLELYWKHAPKTCKNFAELAR---------------RGY--------YNGTKFHRIIKDFMIQGG-DPTGT-GRGGASIY-------------------------G-KQFEDELHPDLKFT-G--A-GI--LAMANA-G---PDTNGSQFFVTLAPTQWLDG-----KHTIFGRVCQ--GIGMVNRV-----GMVE---------
107 HHSearch 65.8138% -17 - C5 -1ZKC PPIL2_HUMAN A:[20-154] --GYVRLHTNKGDLNLELHCDLTPKTCENFIRLCK---------------KHY--------YDGTIFHRSIRNFVIQGG-DPTGT-GTGGESYW-------------------------G-KPFKDEFRPNLSHT-G--R-GI--LSMANS-G---PNSNRSQFFITFRSCAYLDK-----KHTIFGRVVG--GFDVLTAM-----ENVE---------
4 PsiBlast_PDB 65.1148% -33 - C5 -2X7K PPIL1_HUMAN A:[23-136] -------------IVLELYWKHAPKTCKNFAELAR---------------RGY--------YNGTKFHRIIKDFMIQGG-DPTGT-GRGGA----------------------------SIYGKQFEDELHPDLK-F--T-GAGILAMANA-G---PDTNGSQFFVTLAPTQWLDG-----KHTIFGRVCQG-I-------------------------
22 PsiBlast_CBE 65.0244% -9 - C5 -2OJU PPIL3_HUMAN B:[11-132] ------LHTDVGDIKIEVFCERTPKTCENFLALCA---------------SNY--------YNGCIFHRNIKGFMVQTG-DPTGT-GRGGN----------------------------SIWGKKFEDEYSEYLK-HNVR-GV--VSMANN-G---PNTNGSQFFITYGKQPHLDM-----KYTVFGKVIDG-L-E-----------------------
10 PsiBlast_PDB 64.4744% -11 - C5 -2OK3 PPIL3_HUMAN A:[5-126] ------LHTDVGDIKIEVFCERTPKTCENFLALCA---------------SNY--------YNGCIFHRNIKGFMVQTG-DPTGT-GRGGN----------------------------SIWGKKFEDEYSEYLK-HNVR-GV--VSMANN-G---PNTNGSQFFITYGKQPHLDM-----KYTVFGKVIDG-L-E-----------------------
110 HHSearch 63.8237% -6 - C5 -4R3F ? A:[16-176] --GAVIIHTTQGDLKVELFAKQTPLTCRNFLQHSL---------------DGY--------YDGTIFHRLVPGFIIQGG-DPTGT-GHGGESIYDGGAFSGDLDPWPMDQRKGHNAGPMG-VNFKDEFHSRLKFN-R--R-GL--LGMANE-GA--PDTNGSQFFFTLGKAEELNN-----KNTLFGRVAA--GDTIYNLM-----KWGE---------
11 PsiBlast_PDB 63.8144% -20 - C5 -2HQ6 CWC27_HUMAN A:[36-146] -------------IDIELWSKEAPKACRNFIQLCL---------------EAY--------YDNTIFHRVVPGFIVQGG-DPTGT-GSGGESIY-------------------------G-APFKDEFHSRLRFN-R--R-GL--VAMANA-G---SHDNGSQFFFTLGRADELNN-----KHTIFGKVT-----------------------------
29 PsiBlast_CBE 63.8045% -6 - C5 -4HY7 ? A:[19-149] ------------RIVMELYKDAVPRTVENFRALCTGE-------------KGVGKSGKPLHYKGSAFHRVIPDFMCQGGDFTRGN-GTGGE----------------------------SIYGEKFADEKFVHKHTK--P-GI--LSMANA-G---PNTNGSQFFICTVPCNWLDG-----KHVVFGEVVEG-M-DVVKNI------------------
8 PsiBlast_PDB 63.5844% -9 - C5 -2OJU PPIL3_HUMAN A:[11-132] ------LHTDVGDIKIEVFCERTPKTCENFLALCA---------------SNY--------YNGCIFHRNIKGFMVQTG-DPTGT-GRGGN----------------------------SIWGKKFEDEYSEYLK-HNVR-GV--VSMANN-G---PNTNGSQFFITYGKQPHLDM-----KYTVFGKVIDG-L-E-----------------------
88 PsiBlast_CBE 62.6741% 38 - C5 -1NMK PPIA_HUMAN B:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
7 PsiBlast_PDB 62.1944% -17 - C5 -4R3E CWC27_HUMAN A:[26-136] -------------IDIELWSKEAPKACRNFIQLCL---------------EAY--------YDNTIFHRVVPGFIVQGG-DPTGT-GSGGESIY-------------------------G-APFKDEFHSRLRFN-R--R-GL--VAMANA-G---SHDNGSQFFFTLGRADELNN-----KHTIFGKVT-----------------------------
89 PsiBlast_CBE 61.2741% 39 - C5 -1NMK PPIA_HUMAN A:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
63 PsiBlast_CBE 61.1941% 40 - C5 -2RMB PPIA_HUMAN K:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
31 PsiBlast_CBE 61.1741% 47 - C5 -4N1S PPIA_HUMAN A:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
82 PsiBlast_CBE 60.9541% 39 - C5 -1YND PPIA_HUMAN A:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
37 PsiBlast_CBE 60.8241% 46 - C5 -4IPZ PPIA_HUMAN A:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYG-KFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
98 PsiBlast_CBE 60.8141% 44 * C5 *1CWK PPIA_HUMAN A:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
70 PsiBlast_CBE 60.7941% 39 - C5 -2RMA PPIA_HUMAN Q:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
60 PsiBlast_CBE 60.7541% 42 - C5 -2RMB PPIA_HUMAN Q:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
96 PsiBlast_CBE 60.7141% 41 - C5 -1CWM PPIA_HUMAN A:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
25 PsiBlast_CBE 60.4342% 43 - C5 -4DGC PPIA_MACMU C:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGNFT----GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
34 PsiBlast_CBE 60.3441% 43 - C5 -4N1P PPIA_HUMAN A:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
93 PsiBlast_CBE 60.2241% 41 - C5 -1M63 PPIA_HUMAN C:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
90 PsiBlast_CBE 60.1941% 41 - C5 -1MIK PPIA_HUMAN A:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
81 PsiBlast_CBE 59.9041% 42 - C5 -1YND PPIA_HUMAN B:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
40 PsiBlast_CBE 59.8741% 44 - C5 -3ODL PPIA_HUMAN O:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
99 PsiBlast_CBE 59.7841% 42 - C5 -1CWJ PPIA_HUMAN A:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
45 PsiBlast_CBE 59.6541% 45 - C5 -3ODL PPIA_HUMAN E:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
18 PsiBlast_PDB 59.6442% 40 - C5 -4DGC PPIA_MACMU A:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGNFTHHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
80 PsiBlast_CBE 59.5941% 47 - C5 -1ZKF PPIA_HUMAN A:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
72 PsiBlast_CBE 59.5541% 46 - C5 -2RMA PPIA_HUMAN M:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
77 PsiBlast_CBE 59.5241% 44 - C5 -2RMA PPIA_HUMAN C:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
35 PsiBlast_CBE 59.5241% 44 - C5 -4N1O PPIA_HUMAN A:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
53 PsiBlast_CBE 59.5141% 39 - C5 -3ODI PPIA_HUMAN I:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
95 PsiBlast_CBE 59.5041% 45 - C5 -1CWO PPIA_HUMAN A:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
66 PsiBlast_CBE 59.4741% 42 - C5 -2RMB PPIA_HUMAN E:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
57 PsiBlast_CBE 59.4541% 45 - C5 -3ODI PPIA_HUMAN A:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
94 PsiBlast_CBE 59.4141% 43 - C5 -1FGL PPIA_HUMAN A:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
36 PsiBlast_CBE 59.3841% 46 - C5 -4N1N PPIA_HUMAN A:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
92 PsiBlast_CBE 59.3441% 43 - C5 -1M63 PPIA_HUMAN G:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
46 PsiBlast_CBE 59.3141% 42 - C5 -3ODL PPIA_HUMAN C:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
68 PsiBlast_CBE 59.3041% 43 - C5 -2RMB PPIA_HUMAN A:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
97 PsiBlast_CBE 59.2941% 44 - C5 -1CWL PPIA_HUMAN A:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
71 PsiBlast_CBE 59.2941% 40 - C5 -2RMA PPIA_HUMAN O:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
39 PsiBlast_CBE 59.2841% 46 - C5 -3ODL PPIA_HUMAN Q:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
30 PsiBlast_CBE 59.2841% 43 - C5 -3RDD PPIA_HUMAN A:[38-177] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
41 PsiBlast_CBE 59.2541% 43 - C5 -3ODL PPIA_HUMAN M:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
75 PsiBlast_CBE 59.2241% 47 - C5 -2RMA PPIA_HUMAN G:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
67 PsiBlast_CBE 59.2241% 41 - C5 -2RMB PPIA_HUMAN C:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
44 PsiBlast_CBE 59.1441% 45 - C5 -3ODL PPIA_HUMAN G:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
76 PsiBlast_CBE 59.1241% 40 - C5 -2RMA PPIA_HUMAN E:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
51 PsiBlast_CBE 59.1241% 44 - C5 -3ODI PPIA_HUMAN M:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
84 PsiBlast_CBE 59.0841% 44 - C5 -1W8L PPIA_HUMAN A:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
78 PsiBlast_CBE 59.0641% 44 - C5 -2RMA PPIA_HUMAN A:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
61 PsiBlast_CBE 59.0541% 42 - C5 -2RMB PPIA_HUMAN O:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
49 PsiBlast_CBE 59.0441% 45 - C5 -3ODI PPIA_HUMAN Q:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--
50 PsiBlast_CBE 58.9941% 44 - C5 -3ODI PPIA_HUMAN O:[19-158] ------------RVSFELFADKVPKTAENFRALSTGE-------------KGFG-------YKGSCFHRIIPGFMCQGGDFTRHN-GTGGK----------------------------SIYGEKFEDENFILKH-T--GPGI--LSMANA-G---PNTNGSQFFICTAKTEWLDG-----KHVVFGKVKEG-M-NIVEAMERFGSRNGKTSKKITI--