@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv1256c: (2016-04-30 )
MTSVMSHEFQLATAETWPNPWPMYRALRDHDPVHHVVPPQRPEYDYYVLSRHADVWSAARDHQTFSSAQGLTVNYGELEMIGLHDTPPMVMQDPPVHTEFRKLVSRGFTPRQVETVEPTVRKFVVERLEKLRANGGGDIVTELFKPLPSMVVAHYLGVPEEDWTQFDGWTQAIVAANAVDGATTGALDAVGSMMAYFTGLIERRRTEPADDAISHLVAAGVGADGDTAGTLSILAFTFTMVTGGNDTVTGMLGGSMPLLHRRPDQRRLLLDDPEGIPDAVEELLRLTSPVQGLARTTTRDVTIGDTTIPAGRRVLLLYGSANRDERQYGPDAAELDVTRCPRNILTFSHGAHHCLGAAAARMQCRVALTELLARCPDFEVAESRIVWSGGSYVRRPLSVPFRVTS

Atome Classification :

(23 SA) .........10........20........30........40........50........60........70.......--.80......-----..90........100.......110.......120.......130.--...-...140.......150.......160.......170......-.180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290.---.--.--.....300.-......310.......320.......330.......340.......350.......360.......370.....--..--380-.--..--.....-390.......400...
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MTSVMSHEFQLATAETWPNPWPMYRALRDHDPVHHVVPPQRPEYDYYVLSRHADVWSAARDHQTFSSAQGLTVNYGEL--EMIGLHDTP-----PMVMQDPPVHTEFRKLVSRGFTPRQVETVEPTVRKFVVERLEKLRA--NGG-GDIVTELFKPLPSMVVAHYLGVPEEDWTQFDGWTQAIVAANA-VDGATTGALDAVGSMMAYFTGLIERRRTEPADDAISHLVAAGVGADGDTAGTLSILAFTFTMVTGGNDTVTGMLGGSMPLLHRRPDQRRLLLDDPEGIPDAVEELLRLTSPV-QG---L--A--RTTTRDVTI-GDTTIPAGRRVLLLYGSANRDERQYGPDAAELDVTRCPRNILTFSHGAHHCLGAAAARMQCRVALTELLARCPD--FE--VA--E--SR--IVWSG-GSYVRRPLSVPFRVTS
1 PsiBlast_PDB 98.98100%-104 - C4 -2UVN CP130_MYCTU A:[13-412] -----SHEFQLATAETWPNPWPMYRALRDHDPVHHVVPPQRPEYDYYVLSRHADVWSAARDHQTFSSAQGLTVNYGEL--EMIGLHDTP-----PMVMQDPPVHTEFRKLVSRGFTPRQVETVEPTVRKFVVERLEKLRA--NGG-GDIVTELFKPLPSMVVAHYLGVPEEDWTQFDGWTQAIVAAN----GATTGALDAVGSMMAYFTGLIERRRTEPADDAISHLVAAGVGADGDTAGTLSILAFTFTMVTGGNDTVTGMLGGSMPLLHRRPDQRRLLLDDPEGIPDAVEELLRLTSPV-QG---L--A--RTTTRDVTI-GDTTIPAGRRVLLLYGSANRDERQYGPDAAELDVTRCPRNILTFSHGAHHCLGAAAARMQCRVALTELLARCPD--FE--VA--E--SR--IVWSG-GSYVRRPLSVPFRVTS
21 PsiBlast_CBE 98.07100%-111 - C4 -2WH8 CP130_MYCTU C:[12-409] -----SHEFQLATAETWPNPWPMYRALRDHDPVHHVVPPQRPEYDYYVLSRHADVWSAARDHQTFSSAQGLTVNYGEL--EMIGLHDTP-----PMVMQDPPVHTEFRKLVSRGFTPRQVETVEPTVRKFVVERLEKLRA--NGG-GDIVTELFKPLPSMVVAHYLGVPEEDWTQFDGWTQAIVAA---------GALDAVGSMMAYFTGLIERRRTEPADDAISHLVAAGVG--GDTAGTLSILAFTFTMVTGGNDTVTGMLGGSMPLLHRRPDQRRLLLDDPEGIPDAVEELLRLTSPV-QG---L--A--RTTTRDVTI-GDTTIPAGRRVLLLYGSANRDERQYGPDAAELDVTRCPRNILTFSHGAHHCLGAAAARMQCRVALTELLARCPD--FE--VA--E--SR--IVWSG-GSYVRRPLSVPFRV--
114 HHSearch 75.4131% -90 - C4 -4MM0 ? A:[11-399] -------HPYPFDRAVPTAIPPLYEELRETERVAAITMA--TGDPGFLVTRYEDVRFVLSDPR-FSVRQD-LPGA-P----RLTEMTFE-----SVMTTDPPVHTRLRRLLSRDFTARRIERMRPRLEEIAEGLLDEMEKK-GAP-ADIVESLAVPFPITVICELLGVPMVDVARFRGWADTMVSLTG--YSM-EDWTAARDALESYLDGLVAAKRENPGSDLLSALVATAA--EDNELTDHDVRSLSLILLLAGYEPASNQLGSSVLTLLRFPDRLAELRRDPGLLPSAVEELMRYAPAG-DGA--L--F--RVTLEDVTI-GDTHIPANSAVLASTQAANWDPRRF-DDPTGLRLDRPDNQHTALGHGIHFCLGAALARVELQVAIGALLRRF-PR-LA--LA--T--DESGLRWSSPGSMLSGFAEIPVTW--
127 HHSearch 75.3732% -99 - C4 -4WPZ ? A:[6-397] ----------FPDPPSV-ELPPELAEIRDGQSVVEVKFP--DGISGWMVTKHADVRKVLVDS-RFSSKV-----------TETGKLMNE-----SLVGMDAPEHTRLRKLVTKAFTARRVETLRPRITELVGQLLDELETL-PRP-VDLVKNFSVPLPVRVICELLGVPAGDQDTFHAWSNALLG-DW--QQV-VEKEAATVSLVNYFGELIAVKRENPADDLISELIAISD--GDSTLTEREIIALSIGILSAGHETTANQISMFLVTLLHNPEELDKLRDNREAIPKAVDELLRFVPLT-TTGGII--P--RLTTAEVELSGGQVLPAGAVVLPAVATANRDPEVF-EDGERLNVTRENNPHLAFGAGIHHCLGAQLARIELQEALGAILDRMPQ--VR--LA--V--PESELRLKS-ASIIRGLESLPITW--
41 PsiBlast_CBE 74.5635% -97 - C4 -2Y5Z MYCG_MICGR B:[43-414] -----------------------YGELQETEPVSRVRPPYGEEA--WLVTRYEDVRAVLGDGR-FVRGPSMTRDEPRTRPEMV----KG-----GLLSMDPPEHSRLRRLVVKAFTARRAESLRPRAREIAHELVDQMAA--TGQPADLVAMFARQLPVRVICELLGVPSADHDRFTRWSGAFLSTAE-VTAEEMQ--EAAEQAYAYMGDLIDRRRKEPTDDLVSALVQAR--DQQDSLSEQELLDLAIGLLVAGYESTTTQIADFVYLLMTRPELRRQLLDRPELIPSAVEELTRWVPLG-VG---T--AFPRYAVEDVTL-RGVTIRAGEPVLASTGAANRDQAQF-PDADRIDVDRTPNQHLGFGHGVHHCLGAPLARVELQVALEVLLQRLPG--IRLGIP--E--TQ--LRWSE-GMLLRGPLELP-----
97 PsiBlast_CBE 74.3033% -98 - C4 -4Z5P ? B:[24-398] ---------------------PKFAELRETDPLARVRLPYGGEG--WMVTRYDDVRAANSDPR-FSRAQ-------------IG-EDTPRTTPDTILSLDPPEHTRLRRLLSKAFTARRMGAMQSWLEELFAGLLDGVER--TGHPADIVRDLAQPFTIAVICRLLGVPYEDRGRFQHWSEVIMSTTA-Y--SKEEAVSADASIRAYLADLVSARRAAPHDDLLGVLVSAR--DDDDRLTEDELITFGVTLLVAGHETSAHQLGNMVYALLTHEDQLSLLREQPELLPRAVEELLRFVPLG-NG---VGNA--RIALEDVEL-SGGTVRAGEGVVAAAVNANRDPRAFD-DPDRLDITREKNPHLAFGHGAHYCLGAQLARMELRVAIGGLLERFPG--LR--LAVPA--DQ--VEWKT-GGLFRGPQRLPI----
15 PsiBlast_PDB 74.2435% -98 - C4 -2YCA MYCG_MICGR A:[43-414] -----------------------YGELQETEPVSRVRPPYGEEA--WLVTRYEDVRAVLGDGR-FVRGPSMTRDEPRTRPEMV----KG-----GLLSMDPPEHSRLRRLVVKAFTARRAESLRPRAREIAHELVDQMAA--TGQPADLVAMFARQLPVRVICELLGVPSADHDRFTRWSGAFLSTAE-VTAEEMQ--EAAEQAYAYMGDLIDRRRKEPTDDLVSALVQAR--DQQDSLSEQELLDLAIGLLVAGYESTTTQIADFVYLLMTRPELRRQLLDRPELIPSAVEELTRWVPLG-VG---T--AFPRYAVEDVTL-RGVTIRAGEPVLASTGAANRDQAQF-PDADRIDVDRTPNQHLGFGHGVHHCLGAPLARVELQVALEVLLQRLPG--IRLGIP--E--TQ--LRWSE-GMLLRGPLELP-----
13 PsiBlast_PDB 74.2235% -95 - C4 -2Y98 MYCG_MICGR A:[43-414] -----------------------YGELQETEPVSRVRPPYGEEA--WLVTRYEDVRAVLGDGR-FVRGPSMTRDEPRTRPEMV----KG-----GLLSMDPPEHSRLRRLVVKAFTARRAESLRPRAREIAHELVDQMAA--TGQPADLVAMFARQLPVRVICELLGVPSADHDRFTRWSGAFLSTAE-VTAEEMQ--EAAEQAYAYMGDLIDRRRKEPTDDLVSALVQAR--DQQDSLSEQELLDLAIGLLVAGYESTTTQIADFVYLLMTRPELRRQLLDRPELIPSAVEELTRWVPLG-VG---T--AFPRYAVEDVTL-RGVTIRAGEPVLASTGAANRDQAQF-PDADRIDVDRTPNQHLGFGHGVHHCLGAPLARVELQVALEVLLQRLPG--IRLGIP--E--TQ--LRWSE-GMLLRGPLELP-----
11 PsiBlast_PDB 74.1135% -94 - C4 -2Y5N MYCG_MICGR A:[43-414] -----------------------YGELQETEPVSRVRPPYGEEA--WLVTRYEDVRAVLGDGR-FVRGPSMTRDEPRTRPEMV----KG-----GLLSMDPPEHSRLRRLVVKAFTARRAESLRPRAREIAHELVDQMAA--TGQPADLVAMFARQLPVRVICELLGVPSADHDRFTRWSGAFLSTAE-VTAEEMQ--EAAEQAYAYMGDLIDRRRKEPTDDLVSALVQAR--DQQDSLSEQELLDLAIGLLVAGYESTTTQIADFVYLLMTRPELRRQLLDRPELIPSAVEELTRWVPLG-VG---T--AFPRYAVEDVTL-RGVTIRAGEPVLASTGAANRDQAQF-PDADRIDVDRTPNQHLGFGHGVHHCLGAPLARVELQVALEVLLQRLPG--IRLGIP--E--TQ--LRWSE-GMLLRGPLELP-----
36 PsiBlast_CBE 74.0835% -94 - C4 -4AW3 MYCG_MICGR B:[43-414] -----------------------YGELQETEPVSRVRPPYGEEA--WLVTRYEDVRAVLGDGR-FVRGPSMTRDEPRTRPEMV----KG-----GLLSMDPPEHSRLRRLVVKAFTARRAESLRPRAREIAHELVDQMAA--TGQPADLVAMFARQLPVRVICELLGVPSADHDRFTRWSGAFLSTAE-VTAEEMQ--EAAEQAYAYMGDLIDRRRKEPTDDLVSALVQAR--DQQDSLSEQELLDLAIGLLVAGYESTTTQIADFVYLLMTRPELRRQLLDRPELIPSAVEELTRWVPLG-VG---T--AVPRYAVEDVTL-RGVTIRAGEPVLASTGAANRDQAQF-PDADRIDVDRTPNQHLGFGHGVHHCLGAPLARVELQVALEVLLQRLPG--IRLGIP--E--TQ--LRWSE-GMLLRGPLELP-----
9 PsiBlast_PDB 74.0635% -94 - C4 -4AW3 MYCG_MICGR A:[43-414] -----------------------YGELQETEPVSRVRPPYGEEA--WLVTRYEDVRAVLGDGR-FVRGPSMTRDEPRTRPEMV----KG-----GLLSMDPPEHSRLRRLVVKAFTARRAESLRPRAREIAHELVDQMAA--TGQPADLVAMFARQLPVRVICELLGVPSADHDRFTRWSGAFLSTAE-VTAEEMQ--EAAEQAYAYMGDLIDRRRKEPTDDLVSALVQAR--DQQDSLSEQELLDLAIGLLVAGYESTTTQIADFVYLLMTRPELRRQLLDRPELIPSAVEELTRWVPLG-VG---T--AVPRYAVEDVTL-RGVTIRAGEPVLASTGAANRDQAQF-PDADRIDVDRTPNQHLGFGHGVHHCLGAPLARVELQVALEVLLQRLPG--IRLGIP--E--TQ--LRWSE-GMLLRGPLELP-----
2 PsiBlast_PDB 74.0635% -94 - C4 -3A4G CPVDH_PSEAH A:[9-389] ------EQHDLFSGTFWQNPHPAYAALRAEDPVRKLALPDGP---VWLLTRYADVREAFVDPR-LSKDWRHTLPEDQR--ADMPATPTP-----MMILMDPPDHTRLRKLVGRSFTVRRMNELEPRITEIADGLLAGLPT--DGP-VDLMREYAFQIPVQVICELLGVPAEDRDDFSAWSSVLVDDSP-ADDKNA----AMGKLHGYLSDLLERKRTEPDDALLSSLLAVS-DEDGDRLSQEELVAMAMLLLIAGHETTVNLIGNGVLALLTHPDQRKLLAEDPSLISSAVEEFLRFDSPVSQA---P--I--RFTAEDVTY-SGVTIPAGEMVMLGLAAANRDA-DWMPEPDRLDITRDASGGVFFGHGIHFCLGAQLARLEGRVAIGRLFADRPE--LA--LA--VGLDE--LVYRE-STLVR-----------
98 PsiBlast_CBE 74.0133% -98 - C4 -4Z5P ? A:[24-398] ---------------------PKFAELRETDPLARVRLPYGGEG--WMVTRYDDVRAANSDPR-FSRAQ-------------IG-EDTPRTTPDTILSLDPPEHTRLRRLLSKAFTARRMGAMQSWLEELFAGLLDGVER--TGHPADIVRDLAQPFTIAVICRLLGVPYEDRGRFQHWSEVIMSTTA-Y--SKEEAVSADASIRAYLADLVSARRAAPHDDLLGVLVSAR--DDDDRLTEDELITFGVTLLVAGHETSAHQLGNMVYALLTHEDQLSLLREQPELLPRAVEELLRFVPLG-NG---VGNA--RIALEDVEL-SGGTVRAGEGVVAAAVNANRDPRAFD-DPDRLDITREKNPHLAFGHGAHYCLGAQLARMELRVAIGGLLERFPG--LR--LAVPA--DQ--VEWKT-GGLFRGPQRLPI----
79 PsiBlast_CBE 74.0131% -93 * C4 *4BF4 PIKC_STRVZ D:[47-424] ------------------DPYPTYARLRAEGPAHRVRTPEGNEV--WLVVGYDRARAVLADPRFSKDWRNSTTPLTEA--EAALNHN--------MLESDPPRHTRLRKLVAREFTMRRVELLRPRVQEIVDGLVDAMLAAPDGR-ADLMESLAWPLPITVISELLGVPEPDRAAFRVWTDAFVFPDD-PAQAQT----AMAEMSGYLSRLIDSKRGQDGEDLLSALVRTS-DEDGSRLTSEELLGMAHILLVAGHETTVNLIANGMYALLSHPDQLAALRADMTLLDGAVEEMLRYEGPV-ES---A--TY-RFPVEPVDL-DGTVIPAGDTVLVVLADAHRTPERF-PDPHRFDIRRDTAGHLAFGHGIHFCIGAPLARLEARIAVRALLERCPDLALD--VS--P--GE--LVWYP-NPMIRGLKALPIR---
10 PsiBlast_PDB 73.8935% -96 - C4 -2Y46 MYCG_MICGR A:[43-414] -----------------------YGELQETEPVSRVRPPYGEEA--WLVTRYEDVRAVLGDGR-FVRGPSMTRDEPRTRPEMV----KG-----GLLSMDPPEHSRLRRLVVKAFTARRAESLRPRAREIAHELVDQMAA--TGQPADLVAMFARQLPVRVICELLGVPSADHDRFTRWSGAFLSTAE-VTAEEMQ--EAAEQAYAYMGDLIDRRRKEPTDDLVSALVQAR--DQQDSLSEQELLDLAIGLLVAGYESTTTQIADFVYLLMTRPELRRQLLDRPELIPSAVEELTRWVPLG-VG---T--AFPRYAVEDVTL-RGVTIRAGEPVLASTGAANRDQAQF-PDADRIDVDRTPNQHLGFGHGVHHCLGAPLARVELQVALEVLLQRLPG--IRLGIP--E--TQ--LRWSE-GMLLRGPLELP-----
32 PsiBlast_CBE 73.8635% -93 - C4 -3A4Z CPVDH_PSEAH C:[3-389] LTTTGTEQHDLFSGTFWQNPHPAYAALRAEDPVRKLALPDGP---VWLLTRYADVREAFVDPRLSKDWRHRLPEDQRA--DMPATP-TP-----MMILMDPPDHTRLRKLVGRSFTVRRMNELEPRITEIADGLLAGLPT--DGP-VDLMREYAFQIPVQVICELLGLPAEDRDDFSAWSSVLVDDSP-ADDKNA----AMGKLHGYLSDLLERKRTEPDDALLSSLLAVS-DMDGDRLSQEELVAMAMLLLIAGHETTVNLIGNGVLALLTHPDQRKLLAEDPSLISSAVEEFLRFDSPVSQA---P--I--RFTAEDVTY-SGVTIPAGEMVMLGLAAANRDA-DWMPEPDRLDITRDASGGVFFGHGIHFCLGAQLARLEGRVAIGRLFADRPE--LA--LA--VGLDE--LVYRR-STLVR-----------
3 PsiBlast_PDB 73.8635% -92 - C4 -3A4H CPVDH_PSEAH A:[4-389] -TTTGTEQHDLFSGTFWQNPHPAYAALRAEDPVRKLALPDGP---VWLLTRYADVREAFVD