@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PA3774: (2016-02-20 )
MTRRTAFFFDELCLWHAAGPHALTLPVGGWVQPPAAAGHAESPETKRRLKSLLDVSGLTARLQLRSAPPASDEDLLRVHPAHYLERFKALSDAGGGSLGQDAPIGPGSYEIARLSAGLAIAALDAVLAGEADNAYSLSRPPGHHCLPDQAMGFCFFANIAVAIEAAKARHGVERVAVLDWDVHHGNGTQAIYYRRDDVLSISLHQDGCFPPGYSGAEDIGEDRGRGFNLNVPLLPGGGHDAYMQAMQRIVLPALERFRPQLIVVASGFDANAVDPLARMQLHSDSFRAMTAMVRDAAERHAGGRLVVVHEGGYSEAYVPFCGLAVIEELSGVRSAVRDPLRDFIELQQPNAAFRDFQRQRLEELAAQFGLCPAQPLQAAR

Atome Classification :

(52 SA) .........10........20......-..30...-.....40........50.---.......60........70........80..--------......90--.--..-.----------------.-.-..100..-----.-..-----------..110.......120.......130.......140.......150.......160.......170.......180.......190.......200...--.--.---..210.......220.......230----..----.....240.......250.......260.......270....--.....280.......290.......300.......310.......320.......330.......340.......350........360.......370.......380
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MTRRTAFFFDELCLWHAAGPHALTLPV-GGWVQPP-AAAGHAESPETKRRLKSL---LDVSGLTARLQLRSAPPASDEDLLRVHPAHY--------LERFKALS--D--AG-G----------------G-S-LGQDAPI-----G-PG-----------SYEIARLSAGLAIAALDAVLAGEADNAYSLSRPPGHHCLPDQAMGFCFFANIAVAIEAAKARHGVERVAVLDWDVHHGNGTQAIYYRRDDVLSISLHQ--D--G---CFPPGYSGAEDIGEDRGRGFNLNVP----LL----PGGGHDAYMQAMQRIVLPALERFRPQLIVVASGFDA--NAVD--PLARMQLHSDSFRAMTAMVRDAAERHAGGRLVVVHEGGYSEAYVPFCGLAVIEELSGVRSAVRDPLRDFIELQQPNA-AFRDFQRQRLEELAAQFGLCPAQPLQAAR
115 HHSearch 98.4645%-100 - C6 -1ZZ1 HDAH_ALCSD A:[2-367] ---AIGYVWNTLYGWVDTGTGSLAAANLTARMQPISH---HLAHPDTKRRFHEL---VCASGQIEHLTPIAAVAATDADILRAHSAAH--------LENMKRVS--N--LP-TG---------------G-DTGDGITMM-----G-NG-----------GLEIARLSAGGAVELTRRVATGELSAGYALVNPPGHHAPHNAAMGFCIFNNTSVAAGYARAVLGMERVAILDWDVHHGNGTQDIWWNDPSVLTISLHQ--H--L---CFPPDSGYSTERGAGNGHGYNINVP----LP----PGSGNAAYLHAMDQVVLPALRAYRPQLIIVGSGFDA--SMLD--PLARMMVTADGFRQMARRTIDCAADICDGRIVFVQEGGYSPHYLPFCGLAVIEELTGVRS-LPDPYHEFLAGM-GGN-TLLDAERAAIEEIVPLLAD----------
26 PsiBlast_CBE 96.9249% -98 - C6 -2GH6 HDAH_ALCSD B:[36-361] ----------------------------------------HLAHPDTKRRFHEL---VCASGQIEHLTPIAAVAATDADILRAHSAAH--------LENMKRVS--NLPTG-G----------------D-T-GDGITMM-----G-NG-----------GLEIARLSAGGAVELTRRVATGELSAGYALVNPPGHHAPHNAAMGFCIFNNTSVAAGYARAVLGMERVAILDWDVHHGNGTQDIWWNDPSVLTISLHQ--H--L---CFPPDSGYSTERGAGNGHGYNINVP----LP----PGSGNAAYLHAMDQVVLPALRAYRPQLIIVGSGFDA--SMLD--PLARMMVTADGFRQMARRTIDCAADICDGRIVFVQEGGYSPHYLPFCGLAVIEELTGVRS-LPDPYHEFLAGMGGNT-LL-DAERAAIEEI----------------
35 PsiBlast_CBE 96.9049% -99 - C6 -1ZZ0 HDAH_ALCSD B:[36-361] ----------------------------------------HLAHPDTKRRFHEL---VCASGQIEHLTPIAAVAATDADILRAHSAAH--------LENMKRVS--NLPTG-G----------------D-T-GDGITMM-----G-NG-----------GLEIARLSAGGAVELTRRVATGELSAGYALVNPPGHHAPHNAAMGFCIFNNTSVAAGYARAVLGMERVAILDWDVHHGNGTQDIWWNDPSVLTISLHQ--H--L---CFPPDSGYSTERGAGNGHGYNINVP----LP----PGSGNAAYLHAMDQVVLPALRAYRPQLIIVGSGFDA--SMLD--PLARMMVTADGFRQMARRTIDCAADICDGRIVFVQEGGYSPHYLPFCGLAVIEELTGVRS-LPDPYHEFLAGMGGNT-LL-DAERAAIEEI----------------
33 PsiBlast_CBE 96.8649% -99 - C6 -1ZZ0 HDAH_ALCSD D:[36-361] ----------------------------------------HLAHPDTKRRFHEL---VCASGQIEHLTPIAAVAATDADILRAHSAAH--------LENMKRVS--NLPTG-G----------------D-T-GDGITMM-----G-NG-----------GLEIARLSAGGAVELTRRVATGELSAGYALVNPPGHHAPHNAAMGFCIFNNTSVAAGYARAVLGMERVAILDWDVHHGNGTQDIWWNDPSVLTISLHQ--H--L---CFPPDSGYSTERGAGNGHGYNINVP----LP----PGSGNAAYLHAMDQVVLPALRAYRPQLIIVGSGFDA--SMLD--PLARMMVTADGFRQMARRTIDCAADICDGRIVFVQEGGYSPHYLPFCGLAVIEELTGVRS-LPDPYHEFLAGMGGNT-LL-DAERAAIEEI----------------
31 PsiBlast_CBE 96.6349% -99 - C6 -1ZZ1 HDAH_ALCSD C:[36-361] ----------------------------------------HLAHPDTKRRFHEL---VCASGQIEHLTPIAAVAATDADILRAHSAAH--------LENMKRVS--NLPTG-G----------------D-T-GDGITMM-----G-NG-----------GLEIARLSAGGAVELTRRVATGELSAGYALVNPPGHHAPHNAAMGFCIFNNTSVAAGYARAVLGMERVAILDWDVHHGNGTQDIWWNDPSVLTISLHQ--H--L---CFPPDSGYSTERGAGNGHGYNINVP----LP----PGSGNAAYLHAMDQVVLPALRAYRPQLIIVGSGFDA--SMLD--PLARMMVTADGFRQMARRTIDCAADICDGRIVFVQEGGYSPHYLPFCGLAVIEELTGVRS-LPDPYHEFLAGMGGNT-LL-DAERAAIEEI----------------
2 PsiBlast_PDB 96.6349% -99 - C6 -1ZZ1 HDAH_ALCSD A:[36-361] ----------------------------------------HLAHPDTKRRFHEL---VCASGQIEHLTPIAAVAATDADILRAHSAAH--------LENMKRVS--NLPTG-G----------------D-T-GDGITMM-----G-NG-----------GLEIARLSAGGAVELTRRVATGELSAGYALVNPPGHHAPHNAAMGFCIFNNTSVAAGYARAVLGMERVAILDWDVHHGNGTQDIWWNDPSVLTISLHQ--H--L---CFPPDSGYSTERGAGNGHGYNINVP----LP----PGSGNAAYLHAMDQVVLPALRAYRPQLIIVGSGFDA--SMLD--PLARMMVTADGFRQMARRTIDCAADICDGRIVFVQEGGYSPHYLPFCGLAVIEELTGVRS-LPDPYHEFLAGMGGNT-LL-DAERAAIEEI----------------
1 PsiBlast_PDB 96.5149% -98 - C6 -1ZZ0 HDAH_ALCSD A:[36-361] ----------------------------------------HLAHPDTKRRFHEL---VCASGQIEHLTPIAAVAATDADILRAHSAAH--------LENMKRVS--NLPTG-G----------------D-T-GDGITMM-----G-NG-----------GLEIARLSAGGAVELTRRVATGELSAGYALVNPPGHHAPHNAAMGFCIFNNTSVAAGYARAVLGMERVAILDWDVHHGNGTQDIWWNDPSVLTISLHQ--H--L---CFPPDSGYSTERGAGNGHGYNINVP----LP----PGSGNAAYLHAMDQVVLPALRAYRPQLIIVGSGFDA--SMLD--PLARMMVTADGFRQMARRTIDCAADICDGRIVFVQEGGYSPHYLPFCGLAVIEELTGVRS-LPDPYHEFLAGMGGNT-LL-DAERAAIEEI----------------
34 PsiBlast_CBE 96.4549%-101 - C6 -1ZZ0 HDAH_ALCSD C:[36-361] ----------------------------------------HLAHPDTKRRFHEL---VCASGQIEHLTPIAAVAATDADILRAHSAAH--------LENMKRVS--NLPTG-G----------------D-T-GDGITMM-----G-NG-----------GLEIARLSAGGAVELTRRVATGELSAGYALVNPPGHHAPHNAAMGFCIFNNTSVAAGYARAVLGMERVAILDWDVHHGNGTQDIWWNDPSVLTISLHQ--H--L---CFPPDSGYSTERGAGNGHGYNINVP----LP----PGSGNAAYLHAMDQVVLPALRAYRPQLIIVGSGFDA--SMLD--PLARMMVTADGFRQMARRTIDCAADICDGRIVFVQEGGYSPHYLPFCGLAVIEELTGVRS-LPDPYHEFLAGMGGNT-LL-DAERAAIEEI----------------
25 PsiBlast_CBE 96.4449% -99 - C6 -2GH6 HDAH_ALCSD C:[36-361] ----------------------------------------HLAHPDTKRRFHEL---VCASGQIEHLTPIAAVAATDADILRAHSAAH--------LENMKRVS--NLPTG-G----------------D-T-GDGITMM-----G-NG-----------GLEIARLSAGGAVELTRRVATGELSAGYALVNPPGHHAPHNAAMGFCIFNNTSVAAGYARAVLGMERVAILDWDVHHGNGTQDIWWNDPSVLTISLHQ--H--L---CFPPDSGYSTERGAGNGHGYNINVP----LP----PGSGNAAYLHAMDQVVLPALRAYRPQLIIVGSGFDA--SMLD--PLARMMVTADGFRQMARRTIDCAADICDGRIVFVQEGGYSPHYLPFCGLAVIEELTGVRS-LPDPYHEFLAGMGGNT-LL-DAERAAIEEI----------------
23 PsiBlast_CBE 96.3949%-102 - C6 -2VCG HDAH_ALCSD B:[42-367] ----------------------------------------HLAHPDTKRRFHEL---VCASGQIEHLTPIAAVAATDADILRAHSAAH--------LENMKRVS--NLPTG-G----------------D-T-GDGITMM-----G-NG-----------GLEIARLSAGGAVELTRRVATGELSAGYALVNPPGHHAPHNAAMGFCIFNNTSVAAGYARAVLGMERVAILDWDVHHGNGTQDIWWNDPSVLTISLHQ--H--L---CFPPDSGYSTERGAGNGHGYNINVP----LP----PGSGNAAYLHAMDQVVLPALRAYRPQLIIVGSGFDA--SMLD--PLARMMVTADGFRQMARRTIDCAADICDGRIVFVQEGGYSPHYLPFCGLAVIEELTGVRS-LPDPYHEFLAGMGGNT-LL-DAERAAIEEI----------------
29 PsiBlast_CBE 96.3049%-100 - C6 -1ZZ3 HDAH_ALCSD B:[36-361] ----------------------------------------HLAHPDTKRRFHEL---VCASGQIEHLTPIAAVAATDADILRAHSAAH--------LENMKRVS--NLPTG-G----------------D-T-GDGITMM-----G-NG-----------GLEIARLSAGGAVELTRRVATGELSAGYALVNPPGHHAPHNAAMGFCIFNNTSVAAGYARAVLGMERVAILDWDVHHGNGTQDIWWNDPSVLTISLHQ--H--L---CFPPDSGYSTERGAGNGHGYNINVP----LP----PGSGNAAYLHAMDQVVLPALRAYRPQLIIVGSGFDA--SMLD--PLARMMVTADGFRQMARRTIDCAADICDGRIVFVQEGGYSPHYLPFCGLAVIEELTGVRS-LPDPYHEFLAGMGGNT-LL-DAERAAIEEI----------------
24 PsiBlast_CBE 96.1849% -98 - C6 -2GH6 HDAH_ALCSD D:[36-361] ----------------------------------------HLAHPDTKRRFHEL---VCASGQIEHLTPIAAVAATDADILRAHSAAH--------LENMKRVS--NLPTG-G----------------D-T-GDGITMM-----G-NG-----------GLEIARLSAGGAVELTRRVATGELSAGYALVNPPGHHAPHNAAMGFCIFNNTSVAAGYARAVLGMERVAILDWDVHHGNGTQDIWWNDPSVLTISLHQ--H--L---CFPPDSGYSTERGAGNGHGYNINVP----LP----PGSGNAAYLHAMDQVVLPALRAYRPQLIIVGSGFDA--SMLD--PLARMMVTADGFRQMARRTIDCAADICDGRIVFVQEGGYSPHYLPFCGLAVIEELTGVRS-LPDPYHEFLAGMGGNT-LL-DAERAAIEEI----------------
21 PsiBlast_CBE 96.1349%-102 - C6 -2VCG HDAH_ALCSD D:[42-367] ----------------------------------------HLAHPDTKRRFHEL---VCASGQIEHLTPIAAVAATDADILRAHSAAH--------LENMKRVS--NLPTG-G----------------D-T-GDGITMM-----G-NG-----------GLEIARLSAGGAVELTRRVATGELSAGYALVNPPGHHAPHNAAMGFCIFNNTSVAAGYARAVLGMERVAILDWDVHHGNGTQDIWWNDPSVLTISLHQ--H--L---CFPPDSGYSTERGAGNGHGYNINVP----LP----PGSGNAAYLHAMDQVVLPALRAYRPQLIIVGSGFDA--SMLD--PLARMMVTADGFRQMARRTIDCAADICDGRIVFVQEGGYSPHYLPFCGLAVIEELTGVRS-LPDPYHEFLAGMGGNT-LL-DAERAAIEEI----------------
32 PsiBlast_CBE 96.1249%-100 - C6 -1ZZ1 HDAH_ALCSD B:[36-361] ----------------------------------------HLAHPDTKRRFHEL---VCASGQIEHLTPIAAVAATDADILRAHSAAH--------LENMKRVS--NLPTG-G----------------D-T-GDGITMM-----G-NG-----------GLEIARLSAGGAVELTRRVATGELSAGYALVNPPGHHAPHNAAMGFCIFNNTSVAAGYARAVLGMERVAILDWDVHHGNGTQDIWWNDPSVLTISLHQ--H--L---CFPPDSGYSTERGAGNGHGYNINVP----LP----PGSGNAAYLHAMDQVVLPALRAYRPQLIIVGSGFDA--SMLD--PLARMMVTADGFRQMARRTIDCAADICDGRIVFVQEGGYSPHYLPFCGLAVIEELTGVRS-LPDPYHEFLAGMGGNT-LL-DAERAAIEEI----------------
5 PsiBlast_PDB 96.1149%-100 - C6 -2VCG HDAH_ALCSD A:[42-367] ----------------------------------------HLAHPDTKRRFHEL---VCASGQIEHLTPIAAVAATDADILRAHSAAH--------LENMKRVS--NLPTG-G----------------D-T-GDGITMM-----G-NG-----------GLEIARLSAGGAVELTRRVATGELSAGYALVNPPGHHAPHNAAMGFCIFNNTSVAAGYARAVLGMERVAILDWDVHHGNGTQDIWWNDPSVLTISLHQ--H--L---CFPPDSGYSTERGAGNGHGYNINVP----LP----PGSGNAAYLHAMDQVVLPALRAYRPQLIIVGSGFDA--SMLD--PLARMMVTADGFRQMARRTIDCAADICDGRIVFVQEGGYSPHYLPFCGLAVIEELTGVRS-LPDPYHEFLAGMGGNT-LL-DAERAAIEEI----------------
125 Fugue 96.0344% -94 - C6 -1ZZ1 HDAH_ALCSD A:[2-368] ---AIGYVWNTLYGWVDTGTGSLAAAN-LTARMQP-IS-HHLAHPDTKRRFHEL---VCASGQIEHLTPIAAVAATDADILRAHSAAH--------LENMKRVSNLP--TG-G----------------D-T-GDGITMM-----G-NG-----------GLEIARLSAGGAVELTRRVATGELSAGYALVNPPGHHAPHNAAMGFCIFNNTSVAAGYARAVLGMERVAILDWDVHHGNGTQDIWWNDPSVLTISLHQ--H--L---CFPPDSGYSTERGAGNGHGYNINVP----LP----PGSGNAAYLHAMDQVVLPALRAYRPQLIIVGSGFDA--SMLD--PLARMMVTADGFRQMARRTIDCAADICDGRIVFVQEGGYSPHYLPFCGLAVIEELTGVRSL-PDPYHEFLAGMGGNT-LLDAERAAIEEIVPLLADI----------
22 PsiBlast_CBE 96.0049%-100 - C6 -2VCG HDAH_ALCSD C:[42-367] ----------------------------------------HLAHPDTKRRFHEL---VCASGQIEHLTPIAAVAATDADILRAHSAAH--------LENMKRVS--NLPTG-G----------------D-T-GDGITMM-----G-NG-----------GLEIARLSAGGAVELTRRVATGELSAGYALVNPPGHHAPHNAAMGFCIFNNTSVAAGYARAVLGMERVAILDWDVHHGNGTQDIWWNDPSVLTISLHQ--H--L---CFPPDSGYSTERGAGNGHGYNINVP----LP----PGSGNAAYLHAMDQVVLPALRAYRPQLIIVGSGFDA--SMLD--PLARMMVTADGFRQMARRTIDCAADICDGRIVFVQEGGYSPHYLPFCGLAVIEELTGVRS-LPDPYHEFLAGMGGNT-LL-DAERAAIEEI----------------
27 PsiBlast_CBE 95.9049% -99 - C6 -1ZZ3 HDAH_ALCSD D:[36-361] ----------------------------------------HLAHPDTKRRFHEL---VCASGQIEHLTPIAAVAATDADILRAHSAAH--------LENMKRVS--NLPTG-G----------------D-T-GDGITMM-----G-NG-----------GLEIARLSAGGAVELTRRVATGELSAGYALVNPPGHHAPHNAAMGFCIFNNTSVAAGYARAVLGMERVAILDWDVHHGNGTQDIWWNDPSVLTISLHQ--H--L---CFPPDSGYSTERGAGNGHGYNINVP----LP----PGSGNAAYLHAMDQVVLPALRAYRPQLIIVGSGFDA--SMLD--PLARMMVTADGFRQMARRTIDC