@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_1294: (2015-12-22 )
MKAGIIGLGLMGGSLGLALQEWGRFKSVIGYDHNALHAKLALTLGLVDECVEFEKILECDVIFLAIPVEGIIECLKKMTPIKKSATIIDLGGAKAQILHNIPKSIRQNFIAAHPMCGTEFYGPKASVKGLYENALVILCDLEDSGTEQVEIAKEIFLGIKARLIKMKSNEHDTHVAYISHLPHVLSYALANSVLKQNDPEMILSLAGGGFRDMSRLSKSSPLMWKDIFKQNRDNVLEAIEKCEKEIAQAKAWIENNDYESLAEWMAQANKLQEFM

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_C_9(3GGG)
?
[Raw transfer]




NAI_C_9(3GGO)
?
[Raw transfer]




NAD_A_5(2G5C)
?
[Raw transfer]




ENO_C_8(3GGO)
?
[Raw transfer]




TYR_A_3(4WJI)
?
[Raw transfer]




TYR_B_8(3GGG)
?
[Raw transfer]




27 PsiBlast_CBE 95.8031%-116 - C2 -3GGG 9.1 ?
25 PsiBlast_CBE 95.5531%-112 - C2 -3GGO 7.6 ?
1 PsiBlast_PDB 95.1331%-119 - C2 -3GGG - ? -
29 PsiBlast_CBE 94.4231%-118 - C2 -3GGG - ? -
24 PsiBlast_CBE 94.1931%-121 - C2 -3GGO - ? -
26 PsiBlast_CBE 93.9631%-111 - C2 -3GGO - ? -
21 PsiBlast_CBE 93.8731%-116 - C2 -3GGP - ? -
22 PsiBlast_CBE 93.6731%-111 - C2 -3GGP - ? -
2 PsiBlast_PDB 93.6131%-115 - C2 -3GGO - ? -
3 PsiBlast_PDB 93.5531%-116 - C2 -3GGP - ? -
28 PsiBlast_CBE 92.7031%-114 - C2 -3GGG 2.6 ?
23 PsiBlast_CBE 92.4631%-110 - C2 -3GGP - ? -
30 HHSearch 91.7030%-112 - C2 -2G5C 8.7 ?
4 PsiBlast_PDB 91.4930%-119 - C2 -2G5C - ? -
31 HHSearch 90.2829%-103 - C2 -3B1F - ? -
5 PsiBlast_PDB 87.5227%-105 - C2 -3B1F - ? -
32 HHSearch 79.7423% -88 - C2 -3KTD - ? -
7 PsiBlast_PDB 71.4824% -74 - C2 -4WJI 2.8 ?
6 PsiBlast_PDB 69.9729% -52 - C2 -3DZB - ? -
8 PsiBlast_PDB 64.5025% -75 - C2 -3KTD - ? -