@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1439: (2016-03-24 )
MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVAGHPELASKSAEELVTNLDSVPEDIRGAVRNHGGGHANHTLFWSILSPNGGGAPTGNLKAAIESEFGTFDEFKEKFNAAAAARFGSGWAWLVVNDGKLEIVSTANQDSPLSDGKTPVLGLDVWEHAYYLKFQNRRPEYIETFWNVINWDEANKRFDAAK

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PEO_C_9(3K9S)
SODM_ECOLI
[Raw transfer]



PEO_D_11(3K9S)
SODM_ECOLI
[Raw transfer]



PEO_B_7(3K9S)
SODM_ECOLI
[Raw transfer]



O_A_9(2NYB)
SODF_ECOLI
[Raw transfer]
24 PsiBlast_CBE 95.2673% -79 - C6 -2RCV - SODM_BACSU -
22 PsiBlast_CBE 95.0373% -77 - C6 -2RCV - SODM_BACSU -
23 PsiBlast_CBE 94.8273% -80 - C6 -2RCV - SODM_BACSU -
26 PsiBlast_CBE 94.8073% -76 - C6 -2RCV - SODM_BACSU -
2 PsiBlast_PDB 93.7673% -77 - C6 -2RCV - SODM_BACSU -
1 PsiBlast_PDB 93.7671% -79 - C6 -1XUQ - SODM1_BACAN -
25 PsiBlast_CBE 93.4673% -80 - C6 -2RCV - SODM_BACSU -
31 PsiBlast_CBE 93.1458% -77 - C6 -2CDY - SODM_DEIRA -
110 HHSearch 93.0461% -80 - C6 -3KKY - SODM_DEIRA -
21 PsiBlast_CBE 92.9471% -77 - C6 -1XUQ - SODM1_BACAN -
33 PsiBlast_CBE 92.4358% -78 - C6 -2AW9 - SODM_DEIRA -
5 PsiBlast_PDB 92.1958% -80 - C6 -3KKY - SODM_DEIRA -
9 PsiBlast_PDB 92.1058% -77 - C6 -2AW9 - SODM_DEIRA -
32 PsiBlast_CBE 91.9258% -83 - C6 -2CDY - SODM_DEIRA -
34 PsiBlast_CBE 91.9158% -78 - C6 -1Y67 - SODM_DEIRA -
30 PsiBlast_CBE 91.9058% -79 - C6 -2CDY - SODM_DEIRA -
8 PsiBlast_PDB 91.7658% -76 - C6 -1Y67 - SODM_DEIRA -
28 PsiBlast_CBE 91.6358% -82 - C6 -3KKY - SODM_DEIRA -
35 PsiBlast_CBE 91.4358% -82 - C6 -1Y67 - SODM_DEIRA -
36 PsiBlast_CBE 91.3458% -79 - C6 -1Y67 - SODM_DEIRA -
38 PsiBlast_CBE 91.1060% -77 - C6 -3K9S 3.4 SODM_ECOLI
37 PsiBlast_CBE 90.5960% -82 - C6 -3K9S 3.8 SODM_ECOLI
39 PsiBlast_CBE 88.7760% -80 - C6 -3K9S 3.6 SODM_ECOLI
120 HHSearch 83.1850% -77 - C6 -2NYB 2.8 SODF_ECOLI