@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 602_tIV_THECC: (2014-05-11 )
MTLCDIDDKGLADCKPSVTQPNPVDPSPDCCEALKGADLACLCSYKNSMWLPSFGIDPMLALSLPPKCNLQMPPNC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LP3_A_6(2RKN)
DIRL1_ARATH
[Raw transfer]



LP3_A_5(2RKN)
DIRL1_ARATH
[Raw transfer]
1 Fugue 96.1152%-112 - C3 -2RKN 6.4 DIRL1_ARATH
11 HHSearch 95.4553%-112 - C3 -2RKN - DIRL1_ARATH -
23 HHSearch 69.8124%-105 - C3 -1HSS - IAA1_WHEAT -
29 HHSearch 69.8026%-110 - C3 -1BEA - ITRF_MAIZE -
34 SP3 63.4522%-121 - C3 -1HSS - IAA1_WHEAT -
39 SP3 63.3725% -97 - C3 -1BEA - ? -
18 HHSearch 61.5929% -86 - C3 -1T12 - NLTP1_TOBAC -
19 HHSearch 60.6633% -86 - C3 -2ALG - NLTP1_PRUPE -
32 SP3 57.8222% -83 - C3 -1FK5 - NLTP_MAIZE -
28 HHSearch 56.9922% -90 * C3 *1B1U - IAAT_ELECO -
17 HHSearch 56.8233% -74 - C3 -1SIY - NLTP1_VIGRR -
15 HHSearch 54.3228% -60 - C3 -1BWO - NLTP1_WHEAT -
14 HHSearch 53.7728% -57 - C3 -1AFH - NLTP_MAIZE -
27 HHSearch 51.4030% -65 - C3 -2LVF - ? -
37 SP3 51.0419%-116 - C3 -1HYP - ? -
26 HHSearch 50.3722% -73 - C3 -1SM7 - ? -
12 HHSearch 50.3527% -83 - C3 -1N89 - NLT2G_WHEAT -
25 HHSearch 50.1222% -78 - C3 -1W2Q - CONG_ARAHY -
35 SP3 50.0325% -97 - C3 -1S6D - 2SS8_HELAN -
8 Fugue 46.9726% -57 - C3 -1S6D - 2SS8_HELAN -


User Run . : Multi Template Modeling Result:

(3 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LP3_A_6(2RKN)
DIRL1_ARATH
[Raw transfer]



LP3_A_5(2RKN)
DIRL1_ARATH
[Raw transfer]
45 98.94100%-142 - C- -M045 - -
44 93.44100%-128 - C- -M044 - -
46 87.00100%-114 - C- -M046 - -