@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0127: (2015-11-28 )
MELAVGNNAPDFSLPTDSGENLSLSDFFDKKNIVLYFYPKDDTPGCTLEAKGFRDKINDFSSLDTVIIGASRDSIKCHASFKAKYSLPFYLISDENAKMLEKYGVWVEKSMFGKKYMGIERTTFLIDKKDKIVRIWENVKVSGHVNEVLEAVKKI

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CIT_A_3(3DRN)
?
[Raw transfer]




CIT_B_4(3DRN)
?
[Raw transfer]




FMT_A_5(3GKM)
?
[Raw transfer]




BIH_A_3(3GKN)
?
[Raw transfer]




BIH_A_3(3GKN)
?
[Raw transfer]




21 PsiBlast_CBE 85.3747% -92 - C1 -3DRN 4.0 ?
1 PsiBlast_PDB 85.3647% -88 - C1 -3DRN 4.0 ?
81 HHSearch 84.6948% -99 - C1 -3DRN - ? -
2 PsiBlast_PDB 81.9644%-114 - C1 -3IXR - ? -
51 PsiBlast_CBE 78.3131% -90 - C1 -4MH2 - PRDX3_BOVIN -
32 PsiBlast_CBE 78.2231% -82 - C1 -4MH3 - PRDX3_BOVIN -
22 PsiBlast_CBE 77.6843%-136 - C1 -3GKN - ? -
45 PsiBlast_CBE 77.5631% -84 - C1 -4MH2 - PRDX3_BOVIN -
18 PsiBlast_PDB 77.4626%-103 - C1 -3A5W - TDXH_AERPE -
39 PsiBlast_CBE 77.3731% -89 - C1 -4MH3 - PRDX3_BOVIN -
38 PsiBlast_CBE 77.3531% -87 - C1 -4MH3 - PRDX3_BOVIN -
82 HHSearch 77.2035% -90 - C1 -3GKN 4.4 ?
40 PsiBlast_CBE 77.1431% -90 - C1 -4MH2 - PRDX3_BOVIN -
34 PsiBlast_CBE 77.0731% -87 - C1 -4MH3 - PRDX3_BOVIN -
46 PsiBlast_CBE 77.0331% -87 - C1 -4MH2 - PRDX3_BOVIN -
47 PsiBlast_CBE 76.9831% -87 - C1 -4MH2 - PRDX3_BOVIN -
42 PsiBlast_CBE 76.9031% -86 - C1 -4MH2 - PRDX3_BOVIN -
49 PsiBlast_CBE 76.7331% -84 - C1 -4MH2 - PRDX3_BOVIN -
50 PsiBlast_CBE 76.7031% -88 - C1 -4MH2 - PRDX3_BOVIN -
37 PsiBlast_CBE 76.4731% -86 - C1 -4MH3 - PRDX3_BOVIN -
5 PsiBlast_PDB 75.4543%-120 - C1 -3GKN 4.5 ?
4 PsiBlast_PDB 73.8443%-116 - C1 -3GKM 3.5 ?