@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0226: (2015-11-29 )
MVMNTYAKSGVDLKLYNKLMKEVKLVVDENKREEVISEVGSFSALFDFAALSKKYDHPVLVSSTDGVGTKLLIAQEVDKHDTIGIDLVAMCVNDLLAQGATPLFFLDYFATGALNKDVLLSVVQGITEGCKQAKITLVGGETAEMPGMYGNNHYDLAGFVVGVVDKSKILPNYGVMRAGDYIVGLESSGIHSNGFSLVRHIFEDLGISYNDLSPWDNQLWGEVLLKPTKIYVDSLLPIMSQVKGIAHITGGGLIDNVPRILPKNLFADVDISSLEWPDIFLWLTKEGKVEKREMLRTFNCGIGMILIIDPENMQGVKNHFQKLGEKIEIIGKLNEKYNPSFNGVVS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CIT_A_4(3P4E)
PUR5_VIBCH
[Raw transfer]




2 PsiBlast_PDB 94.8448%-122 - C5 -3P4E 4.2 PUR5_VIBCH
5 PsiBlast_PDB 91.7646%-120 - C5 -2Z01 - PUR5_GEOKA -
27 HHSearch 91.1545%-118 - C5 -2Z01 - PUR5_GEOKA -
24 PsiBlast_CBE 91.1249%-128 - C5 -2V9Y - -
4 PsiBlast_PDB 90.9546%-115 - C5 -2BTU - PUR5_BACAN -
3 PsiBlast_PDB 90.1349%-128 - C5 -2V9Y - PUR2_HUMAN -
26 HHSearch 89.6547%-110 - C5 -2BTU - PUR5_BACAN -
28 HHSearch 89.3736%-117 - C5 -3M84 - ? -
22 PsiBlast_CBE 87.6352%-121 - C5 -1CLI - PUR5_ECOLI -
1 PsiBlast_PDB 87.2352%-121 - C5 -1CLI - PUR5_ECOLI -
23 PsiBlast_CBE 86.1452%-127 - C5 -1CLI - PUR5_ECOLI -
21 PsiBlast_CBE 85.7152%-128 - C5 -1CLI - PUR5_ECOLI -
7 PsiBlast_PDB 82.5337%-124 - C5 -3QTY - ? -
6 PsiBlast_PDB 82.3937%-126 - C5 -3M84 - ? -
8 PsiBlast_PDB 72.4623%-110 - C5 -3KIZ - ? -
29 HHSearch 71.2922% -97 - C5 -3KIZ - ? -
30 HHSearch 69.5524%-104 - C5 -3MDO - ? -
9 PsiBlast_PDB 66.2223%-106 - C5 -3MDO - ? -
49 Fugue 62.9339%-125 - C5 -1CLI - PUR5_ECOLI -
54 Fugue 62.0920% -91 - C5 -2Z1U - ? -