@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA0145: (2016-03-12 )
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDMCKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVDTPPVNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_B_6(3BFV)
CAP8A_STAAU
[Raw transfer]




ADP_A_5(3BFV)
CAP8A_STAAU
[Raw transfer]




ADP_A_3(2VED)
?
[Raw transfer]




ADP_B_5(2VED)
?
[Raw transfer]




1 PsiBlast_PDB 97.1557% -78 - C1 -3BFV 5.8 CAP8A_STAAU
21 PsiBlast_CBE 96.6957% -76 - C1 -3BFV 6.3 CAP8A_STAAU
2 PsiBlast_PDB 96.4257% -73 - C1 -2VED 6.0 ?
22 PsiBlast_CBE 95.9257% -73 - C1 -2VED 5.1 ?
29 HHSearch 79.3035% -72 - C1 -3LA6 - WZC_ECOLI -
23 PsiBlast_CBE 75.9734% -68 - C1 -3CIO - -
30 HHSearch 74.8734% -64 - C1 -3CIO - ETK_ECOLI -
3 PsiBlast_PDB 74.0034% -68 - C1 -3CIO - ETK_ECOLI -
51 Fugue 72.5132% -60 - C1 -3CIO - ETK_ECOLI -
6 PsiBlast_PDB 64.4425% -68 - C1 -1G3R - ? -
5 PsiBlast_PDB 64.4425% -65 - C1 -1G3Q - ? -
17 PsiBlast_PDB 64.3522% -66 - C1 -4RZ3 - ? -
36 HHSearch 64.3021% -70 * C1 *3Q9L - MIND_ECOLI -
4 PsiBlast_PDB 64.2527% -70 - C1 -1ION - ? -
31 HHSearch 64.0323% -62 - C1 -1G3Q - ? -
18 PsiBlast_PDB 62.3623% -70 - C1 -4V02 - ? -
7 PsiBlast_PDB 62.3024% -68 - C1 -1HYQ - ? -
60 Fugue 62.1520% -68 - C1 -3K9G - ? -
33 HHSearch 61.3123% -63 - C1 -1HYQ - ? -
16 PsiBlast_PDB 60.4623% -75 - C1 -4V03 - ? -