@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0205: (2016-03-13 )
MKFKKVVLGMCLIASVLVFPVTIKANACCDEYLQTPAAPHDIDSKLPHKLSWSADNPTNTDVNTHYWLFKQAEKILAKDVNHMRANLMNELKKFDKQIAQGIYDADHKNPYYDTSTFLSHFYNPDRDNTYLPGFANAKITGAKYFNQSVTDYREGKFDTAFYKLGLAIHYYTDISQPMHANNFTAISYPPGYHCAYENYVDTIKHNYQATEDMVAKRFCSDDVKDWLYENAKRAKADYPKIVNAKTKKSYLVGNSEWKKDTVEPTGARLRDSQQTLAGFLEFWSKKTNE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

3PC_A_5(1P6D)
PHLC_BACCE
[Raw transfer]



PC5_A_5(1P6E)
PHLC_BACCE
[Raw transfer]
3 PsiBlast_PDB 96.9239% -51 - C6 -2HUC - PHLC_BACCE -
21 HHSearch 96.8239% -44 - C6 -1AH7 - PHLC_BACCE -
1 PsiBlast_PDB 96.1839% -49 - C6 -1AH7 - PHLC_BACCE -
5 PsiBlast_PDB 95.9739% -52 - C6 -1P5X - PHLC_BACCE -
7 PsiBlast_PDB 95.8439% -49 - C6 -1P6E 4.1 PHLC_BACCE
4 PsiBlast_PDB 95.2539% -49 - C6 -2FGN - PHLC_BACCE -
6 PsiBlast_PDB 95.1839% -50 - C6 -1P6D 5.4 PHLC_BACCE
2 PsiBlast_PDB 94.3639% -49 - C6 -2FFZ - PHLC_BACCE -
10 PsiBlast_PDB 69.0725% -65 - C6 -1GYG - PHLC1_CLOPE -
22 HHSearch 67.1323% -25 * C6 *1OLP - ? -
11 PsiBlast_PDB 65.6925% -58 - C6 -1CA1 - PHLC1_CLOPE -
13 PsiBlast_PDB 61.5625% -56 - C6 -1QMD - PHLC1_CLOPE (first) -
12 PsiBlast_PDB 61.0725% -58 - C6 -1QM6 - PHLC1_CLOPE (first) -
16 PsiBlast_PDB 58.6025% -54 - C6 -2WY6 - PHLC_CLOP1 -
15 PsiBlast_PDB 57.2225% -53 - C6 -2WXU - PHLC_CLOP1 -
32 Fugue 54.8214% -34 - C6 -4EEI - ? -
8 PsiBlast_PDB 54.6826% -32 - C6 -1OLP - ? -
9 PsiBlast_PDB 53.9128% -40 - C6 -1KHO - PHLC_CLOPF -
35 Fugue 51.8016% -38 - C6 -4ZUZ - ? -
23 HHSearch 48.8015% -26 - C6 -3SNG - ? -