@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1688: (2016-03-27 )
MNKVALVTGSSRGLGREIAIALAKEGYDIAVNFSRNRKKAEEVQQEIEQLGRKCVIFKANVGDVEKVRELFKAVDEEFGRLDIFINNAASGVLRPLMELEESHWDWTMNINAKALLFAGQEAAKLMQRHQSGKIISLSSIGSIRYLENYTTVGVSKAAVESLTRYLAVELAPFGIAVNAVSGGLIETDALNHFPNREELLKDAVSKTPAGRMIEPNDLVNAVLFLASEKADMIRGQTILVDGGRTLLV

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NDP_A_6(3OID)
FABL_BACSU
[Raw transfer]




NDP_D_12(3OID)
FABL_BACSU
[Raw transfer]




NDP_C_10(3OID)
FABL_BACSU
[Raw transfer]




NDP_B_8(3OID)
FABL_BACSU
[Raw transfer]




NDP_A_3(3SJ7)
?
[Raw transfer]




PEG_A_6(3OSU)
FABG_STAAM
[Raw transfer]




EDO_A_7(4I08)
FABG_VIBCH
[Raw transfer]




22 PsiBlast_CBE 92.1769% -89 - C1 -3OID 12.0 FABL_BACSU
23 PsiBlast_CBE 90.9369% -88 - C1 -3OID 12.2 FABL_BACSU
24 PsiBlast_CBE 90.8369% -99 - C1 -3OIC - FABL_BACSU -
21 PsiBlast_CBE 90.6369% -86 - C1 -3OID 12.3 FABL_BACSU
2 PsiBlast_PDB 90.6369% -88 - C1 -3OID 12.6 FABL_BACSU
1 PsiBlast_PDB 88.4569%-105 - C1 -3OIC - FABL_BACSU -
27 PsiBlast_CBE 74.2741% -81 - C1 -4JRO - ? -
6 PsiBlast_PDB 73.1540% -88 - C1 -3OSU 2.4 FABG_STAAM
43 PsiBlast_CBE 72.6335% -84 - C1 -1VL8 - ? -
42 PsiBlast_CBE 72.0935% -84 - C1 -1VL8 - ? -
4 PsiBlast_PDB 71.7541% -79 - C1 -4JRO - ? -
37 PsiBlast_CBE 70.0932% -81 - C1 -1G0O - T4HR_MAGO7 -
26 PsiBlast_CBE 69.8041% -75 - C1 -4JRO - ? -
8 PsiBlast_PDB 69.2338% -89 - C1 -4ZA2 - ? -
32 PsiBlast_CBE 69.1538% -90 - C1 -4Z9Y - ? -
128 HHSearch 68.9431% -84 - C1 -2ZAT - DHRS4_PIG -
25 PsiBlast_CBE 68.7542% -77 - C1 -3SJ7 - ? -
7 PsiBlast_PDB 68.7138% -89 - C1 -4Z9Y - ? -
33 PsiBlast_CBE 68.6934% -84 - C1 -4IBO - ? -
112 HHSearch 68.3428% -85 - C1 -2CFC - HCDR_XANP2 -
101 PsiBlast_CBE 65.4632% -83 - C1 -4I08 3.0 FABG_VIBCH
3 PsiBlast_PDB 64.9942% -72 - C1 -3SJ7 9.4 ?