@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1749: (2016-03-28 )
MGAGKTTVGNILANLADLPYIDIDEVITSEQGMSVSDIFAKYGEKEFRRLEHEKLKELATTKAVIATGGGIVLNPENREVLKNTYPVIYLETDPEVFMNRLKGDTTRPLVQQKTAEEIRAIFEPRIAHYQDSADFIVNTDNRNQQEVAQTILTMLDK

Atome Classification :

(32 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

S3P_A_2(2IYZ)
AROK_MYCTU
[Raw transfer]




S3P_A_3(3MUF)
AROK_HELPY
[Raw transfer]




SKM_C_3(1ZUI)
AROK_HELPY
[Raw transfer]




S3P_A_2(2IYY)
AROK_MYCTU
[Raw transfer]




SKM_A_4(2DFN)
AROK_MYCTU
[Raw transfer]




SKM_A_2(2IYQ)
AROK_MYCTU
[Raw transfer]




K2Q_A_5(4BQS)
AROK_MYCTU
[Raw transfer]




SKM_B_4(2IYR)
AROK_MYCTU
[Raw transfer]




SKM_C_3(1ZYU)
AROK_MYCTU
[Raw transfer]




K2Q_B_7(4BQS)
AROK_MYCTU
[Raw transfer]




SKM_A_6(1U8A)
AROK_MYCTU
[Raw transfer]




SKM_A_3(3BAF)
AROK_MYCTU
[Raw transfer]




K2Q_C_9(4BQS)
AROK_MYCTU
[Raw transfer]




SKM_A_7(2G1K)
AROK_MYCTU
[Raw transfer]




SKM_A_2(2IYX)
AROK_MYCTU
[Raw transfer]




SKM_A_3(2IYR)
AROK_MYCTU
[Raw transfer]




SKM_A_2(2IYS)
AROK_MYCTU
[Raw transfer]




OSA_A_4(3N2E)
AROK_HELPY
[Raw transfer]




DHK_A_6(1WE2)
AROK_MYCTU
[Raw transfer]




OSA_B_7(3N2E)
AROK_HELPY
[Raw transfer]




ADP_B_7(2SHK)
AROL_DICCH
[Raw transfer]




PEG_A_6(3VAA)
AROK_BACTN
[Raw transfer]




PEG_A_6(3VAA)
AROK_BACTN
[Raw transfer]




48 Fugue 94.1035% -79 - C2 -1SHK - AROL_DICCH -
17 PsiBlast_PDB 94.0237% -70 - C2 -2IYS 3.1 AROK_MYCTU
14 PsiBlast_PDB 93.9137% -76 - C2 -4BQS 4.1 AROK_MYCTU
29 PsiBlast_CBE 93.8437% -77 - C2 -2IYZ 4.0 AROK_MYCTU
47 Fugue 93.3636% -79 - C2 -1SHK - AROL_DICCH -
5 PsiBlast_PDB 93.1937% -79 - C2 -1L4Y - AROK_MYCTU -
32 PsiBlast_CBE 93.1837% -69 - C2 -2IYW - AROK_MYCTU -
18 PsiBlast_PDB 93.1537% -70 - C2 -2IYT - AROK_MYCTU -
4 PsiBlast_PDB 93.0537% -77 - C2 -1L4U - AROK_MYCTU -
11 PsiBlast_PDB 92.9537% -71 - C2 -2DFN 2.9 AROK_MYCTU
8 PsiBlast_PDB 92.7837% -77 - C2 -1ZYU 3.1 AROK_MYCTU
13 PsiBlast_PDB 92.7537% -83 - C2 -3BAF 2.6 AROK_MYCTU
58 HHSearch 92.3637% -85 - C2 -2PT5 - AROK_AQUAE -
31 PsiBlast_CBE 92.1737% -73 - C2 -2IYX 3.4 AROK_MYCTU
34 PsiBlast_CBE 92.0837% -75 - C2 -3TRF - AROK_COXBU -
23 PsiBlast_CBE 92.0237% -74 - C2 -4BQS 4.0 AROK_MYCTU
10 PsiBlast_PDB 91.9437% -76 - C2 -2G1K 3.3 AROK_MYCTU
19 PsiBlast_PDB 91.6637% -70 - C2 -2IYU - AROK_MYCTU -
30 PsiBlast_CBE 91.6337% -76 - C2 -2IYY 3.8 AROK_MYCTU
33 PsiBlast_CBE 91.6237% -73 - C2 -2IYR 3.8 AROK_MYCTU
24 PsiBlast_CBE 91.0437% -73 - C2 -4BQS 4.1 AROK_MYCTU
15 PsiBlast_PDB 90.9037% -71 - C2 -2IYQ 3.9 AROK_MYCTU
7 PsiBlast_PDB 90.8437% -68 - C2 -1WE2 3.1 AROK_MYCTU
6 PsiBlast_PDB 90.8437% -74 - C2 -1U8A 3.2 AROK_MYCTU
16 PsiBlast_PDB 90.3037% -66 - C2 -2IYR 2.9 AROK_MYCTU
43 PsiBlast_CBE 88.3336% -80 - C2 -1ZUI 4.9 AROK_HELPY
61 HHSearch 87.4834% -83 - C2 -3VAA 2.2 AROK_BACTN
21 PsiBlast_CBE 83.6936% -68 - C2 -2SHK 5.0 AROL_DICCH
40 PsiBlast_CBE 81.9836% -73 - C2 -3MUF 4.6 AROK_HELPY
46 PsiBlast_CBE 78.6434% -68 - C2 -3VAA 2.1 AROK_BACTN
39 PsiBlast_CBE 74.6036% -65 - C2 -3N2E 5.8 AROK_HELPY
38 PsiBlast_CBE 72.8936% -61 - C2 -3N2E 6.1 AROK_HELPY