@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2664: (2016-04-06 )
MRAAVLYENNVIKAEQIDEATCGKDQVRVEVKAVGICGSDIHKMQTRWKYPLPAVMGHEFAGVITEIGSEVTNVAMGDRVAGIPLEPCMECNYCKAGDFALCDNYRMVGSHFHGGFAENVVMKADNVISIGDLDFEEGAMIEPLAVSMHGVLGIQPRLGDTVIVFGIGTIGILVVQCLLLAGVKDIIAVDISDKKLADAREFGCKYTINPKNEDLKERVFAYTNGLGADIALECAGSKITQEQCLLVTKKKGKVGFLGIAYADVLLHEEAFENIFRRELTLKGFWNSYSAPFPGEEWRTSIEFVKQGRIKLKPLISHRYKLEETKEAFDMILSREHDYNKVMILPQKGDD

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TRS_B_9(4UEK)
?
[Raw transfer]




GOL_B_9(4UEJ)
?
[Raw transfer]




ACY_A_5(3QE3)
DHSO_SHEEP
[Raw transfer]




9 PsiBlast_PDB 83.4629%-119 - C1 -1E3J - ? -
57 HHSearch 79.8529%-110 - C1 -1E3J - ? -
4 PsiBlast_PDB 77.1834% -95 - C1 -4UEO - ? -
23 PsiBlast_CBE 76.5234% -94 - C1 -4UEJ 3.4 ?
2 PsiBlast_PDB 75.4734% -94 - C1 -4UEJ - ? -
22 PsiBlast_CBE 75.0934% -93 - C1 -4UEK 3.6 ?
3 PsiBlast_PDB 75.0634% -93 - C1 -4UEK - ? -
1 PsiBlast_PDB 74.6634% -95 - C1 -4A2C - GATD_ECOLI -
24 PsiBlast_CBE 74.5034% -95 - C1 -4A2C - GATD_ECOLI -
49 HHSearch 74.2030%-102 * C1 *2DQ4 - TDH_THET8 -
11 PsiBlast_PDB 74.0830%-108 - C1 -2DFV - TDH_PYRHO -
45 HHSearch 73.9029%-101 - C1 -2EIH - ? -
21 PsiBlast_CBE 73.2734% -89 - C1 -4UEO - ? -
28 PsiBlast_CBE 72.0831%-107 - C1 -3PII - ADH3_GEOSE -
44 HHSearch 71.7229%-108 - C1 -2D8A - TDH_PYRHO -
26 PsiBlast_CBE 71.6031%-103 - C1 -1RJW - ADH3_GEOSE -
29 PsiBlast_CBE 71.1331%-105 - C1 -3PII - ADH3_GEOSE -
27 PsiBlast_CBE 70.8331%-102 - C1 -1RJW - ADH3_GEOSE -
14 PsiBlast_PDB 70.7231%-106 - C1 -3PII - ADH3_GEOSE -
13 PsiBlast_PDB 70.6831%-102 - C1 -1RJW - ADH3_GEOSE -