@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2831: (2016-04-07 )
MTTALKGVVFDLDGVITDTAHYHYLAWKKTAESIGIEFDEAFNENLKGVSRIDSLLLILRKDGRENDFTEEQIEALAADKNDFYVSLLKEITPADVLPGIKELIVDLKKQNLKCAIASVSKNARTVLSALEMEQEFDYIVDAAKITKSKPDPEIFVEACRGLGLETSEVVGIEDAQAGIEAINAAGIVSVGVGSGLRDADMTVKSTGLLDLRILEILHSK

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

G16_A_2(1O03)
PGMB_LACLA
[Raw transfer]




G16_A_2(1O08)
PGMB_LACLA
[Raw transfer]




BG6_A_2(2WF5)
PGMB_LACLA
[Raw transfer]




BG6_A_4(2WF6)
PGMB_LACLA
[Raw transfer]




BG6_A_3(3ZI4)
PGMB_LACLA
[Raw transfer]




G7P_A_4(2WF7)
PGMB_LACLA
[Raw transfer]




GL1_A_5(1Z4N)
PGMB_LACLA
[Raw transfer]




G7P_A_4(2WF7)
PGMB_LACLA
[Raw transfer]




GRX_A_2(4C4T)
PGMB_LACLA
[Raw transfer]




GL1_B_6(1Z4N)
PGMB_LACLA
[Raw transfer]




GL1_A_5(1Z4O)
PGMB_LACLA
[Raw transfer]




G6P_A_3(2WF9)
PGMB_LACLA
[Raw transfer]




GRX_A_2(4C4S)
PGMB_LACLA
[Raw transfer]




G1P_A_4(2WF8)
PGMB_LACLA
[Raw transfer]




YO5_A_3(4C4R)
PGMB_LACLA
[Raw transfer]




GL1_B_6(1Z4O)
PGMB_LACLA
[Raw transfer]




MGF_A_4(4C4R)
PGMB_LACLA
[Raw transfer]




21 PsiBlast_CBE 97.2247%-109 - C1 -4GIB - ? -
2 PsiBlast_PDB 97.0647%-104 - C1 -4GIB - ? -
1 PsiBlast_PDB 96.1052%-107 - C1 -4G9B - PGMB_ECOLI -
49 HHSearch 93.3346%-110 - C1 -2WF7 3.7 PGMB_LACLA
14 PsiBlast_PDB 87.7848%-105 - C1 -2WF9 4.5 PGMB_LACLA
10 PsiBlast_PDB 87.6848%-109 - C1 -2WHE - PGMB_LACLA -
15 PsiBlast_PDB 87.4548%-105 - C1 -2WFA - PGMB_LACLA -
8 PsiBlast_PDB 87.3548%-108 - C1 -1ZOL - PGMB_LACLA -
12 PsiBlast_PDB 87.1348%-101 - C1 -2WF6 4.1 PGMB_LACLA
20 PsiBlast_PDB 86.5948%-105 - C1 -3FM9 - PGMB_LACLA -
18 PsiBlast_PDB 86.5548%-102 - C1 -4C4S 6.8 PGMB_LACLA
16 PsiBlast_PDB 86.4848%-100 - C1 -3ZI4 4.6 PGMB_LACLA
9 PsiBlast_PDB 86.1948%-100 - C1 -2WF5 4.4 PGMB_LACLA
11 PsiBlast_PDB 86.1848%-100 - C1 -2WF7 3.7 PGMB_LACLA
5 PsiBlast_PDB 86.1048%-104 - C1 -1O08 5.0 PGMB_LACLA
4 PsiBlast_PDB 85.9748%-103 - C1 -1O03 5.4 PGMB_LACLA
19 PsiBlast_PDB 85.8248% -98 - C1 -4C4T 5.9 PGMB_LACLA
6 PsiBlast_PDB 85.7248% -97 - C1 -1Z4N 4.4 PGMB_LACLA
13 PsiBlast_PDB 85.4148%-100 - C1 -2WF8 3.6 PGMB_LACLA
17 PsiBlast_PDB 84.8748% -96 - C1 -4C4R 6.6 PGMB_LACLA
7 PsiBlast_PDB 84.3148% -97 - C1 -1Z4O 4.7 PGMB_LACLA
22 PsiBlast_CBE 83.1348%-101 - C1 -1Z4O 4.2 PGMB_LACLA
23 PsiBlast_CBE 81.3448% -98 - C1 -1Z4N 4.4 PGMB_LACLA