@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu03410: (2016-06-05 )
MIHQHPESFPKHFLWGSASAAYQIEGAWNEDGKGPSVWDVFTKIPGKTFKGTNGEIAVDHYHRFKEDVALMAEMGLKAYRFSVSWPRVFPKGKGEINEAGLAFYDSLIDELLSHHIEPVLTLYHWDLPQALMDEYGGFESRNIIEDFNHYCITLYKRFGDRVKYWVTLNEQNYNFNHGFITAMHPPGVKDRKRFYEANHIAFLANAKAIESFREYVPEGKIGPSFAYSPAYPLSSHPEDILAFENAEEFTNNWWLDMYCWGTYPQIPFRCLEKQGWAPTIEAGDMDLLAKGKPDFVGVNYYQTITYERNPLDGVSEGKMNTTGQKGTNQETGIPGVFKTKKNPHLTTSNWDWTIDPIGLRIGLRRITSRYQLPVFITENGLGEFDKVEDGTVQDDYRIDYLRSHLEQCRQAISDGVDLIGYCSWSFTDLLSWLNGYQKRYGFVYVNRDEESTSDLKRLKKKSFYWYQDVIKTNGESL

Atome Classification :

(66 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GI4_B_5(2J7G)
BGLA_THEMA
[Raw transfer]




GI1_B_5(2J7D)
BGLA_THEMA
[Raw transfer]




GIM_B_7(2CES)
BGLA_THEMA
[Raw transfer]




NTZ_B_5(2J7B)
BGLA_THEMA
[Raw transfer]




BGC_A_2(4HZ8)
?
[Raw transfer]




NOY_B_6(2J75)
BGLA_THEMA
[Raw transfer]




GTL_B_5(2J79)
BGLA_THEMA
[Raw transfer]




NOJ_A_3(1OIM)
BGLA_THEMA
[Raw transfer]




GOX_A_7(2J78)
BGLA_THEMA
[Raw transfer]




CTS_B_6(2CBU)
BGLA_THEMA
[Raw transfer]




TCB_B_6(4PTV)
?
[Raw transfer]




GI2_B_5(2J7E)
BGLA_THEMA
[Raw transfer]




CGB_B_5(2CBV)
BGLA_THEMA
[Raw transfer]




GOX_B_9(2J78)
BGLA_THEMA
[Raw transfer]




GIM_A_4(2CES)
BGLA_THEMA
[Raw transfer]




BGC_A_2(3WH6)
?
[Raw transfer]




OXZ_A_3(1W3J)
BGLA_THEMA
[Raw transfer]




IFL_B_4(1UZ1)
BGLA_THEMA
[Raw transfer]




IFM_B_4(1OIF)
BGLA_THEMA
[Raw transfer]




NOJ_B_4(1OIM)
BGLA_THEMA
[Raw transfer]




OXZ_B_4(1W3J)
BGLA_THEMA
[Raw transfer]




NOJ_B_5(2J77)
BGLA_THEMA
[Raw transfer]




AZF_B_7(2J7H)
BGLA_THEMA
[Raw transfer]




BG6_A_3(4F66)
?
[Raw transfer]




BGC_A_2(4HZ7)
?
[Raw transfer]




GTL_A_3(2J79)
BGLA_THEMA
[Raw transfer]




GI4_A_3(2J7G)
BGLA_THEMA
[Raw transfer]




NOY_A_4(2J75)
BGLA_THEMA
[Raw transfer]




IFM_A_3(1OIF)
BGLA_THEMA
[Raw transfer]




GOL_S_19(2DGA)
HGL1B_WHEAT
[Raw transfer]




GOL_A_3(3WH5)
?
[Raw transfer]




CGB_A_3(2CBV)
BGLA_THEMA
[Raw transfer]




CTS_A_3(2CBU)
BGLA_THEMA
[Raw transfer]




IFL_A_3(1UZ1)
BGLA_THEMA
[Raw transfer]




GOL_M_24(1E4M)
MYRA_SINAL
[Raw transfer]




IFM_A_3(3WH8)
?
[Raw transfer]




SRT_A_24(3CMJ)
?
[Raw transfer]




GOL_A_3(4IPL)
?
[Raw transfer]




YLL_B_6(2JAL)
BGLA_THEMA
[Raw transfer]




NCW_B_7(2VRJ)
BGLA_THEMA
[Raw transfer]




FCB_A_2(3WH7)
?
[Raw transfer]




GLC_A_2(3WBE)
BGL06_ORYSJ
[Raw transfer]




G2F_A_3(1OIN)
BGLA_THEMA
[Raw transfer]




G2F_B_4(1OIN)
BGLA_THEMA
[Raw transfer]




NCW_A_3(2VRJ)
BGLA_THEMA
[Raw transfer]




G2F_A_2(3GNR)
BGL06_ORYSJ
[Raw transfer]




TRS_A_2(3GNO)
BGL06_ORYSJ
[Raw transfer]




3 PsiBlast_PDB 96.0040% -99 - C3 -4F79 - ? -
25 PsiBlast_CBE 95.4640% -99 - C3 -4GPN - ? -
24 PsiBlast_CBE 94.7140% -95 - C3 -4F66 - ? -
4 PsiBlast_PDB 94.2340% -96 - C3 -4GPN - ? -
19 PsiBlast_PDB 94.0438% -95 - C3 -3QOM - ? -
2 PsiBlast_PDB 93.8640% -94 - C3 -4F66 - ? -
108 HHSearch 93.5641% -92 - C3 -3QOM - ? -
20 PsiBlast_PDB 93.3138% -94 - C3 -4GZE - ? -
13 PsiBlast_PDB 91.2840% -89 - C3 -3PN8 - ? -
21 PsiBlast_CBE 89.8039% -90 - C3 -2XHY - BGLA_ECOLI -
118 HHSearch 89.7742% -86 - C3 -2XHY - BGLA_ECOLI -
1 PsiBlast_PDB 88.0739% -87 - C3 -2XHY - BGLA_ECOLI -
29 PsiBlast_CBE 88.0039% -83 - C3 -4PTX - ? -
22 PsiBlast_CBE 87.8539% -89 - C3 -2XHY - BGLA_ECOLI -
23 PsiBlast_CBE 87.8439% -88 - C3 -2XHY - BGLA_ECOLI -
8 PsiBlast_PDB 87.8339% -84 - C3 -4PTX - ? -
121 Fugue 87.6942% -91 - C3 -1QOX - BGLA_BACCI -
111 HHSearch 87.6142% -80 - C3 -4F66 6.0 ?
11 PsiBlast_PDB 87.5839% -86 - C3 -4IPN - ? -
48 PsiBlast_CBE 87.2239% -85 - C3 -2WC3 - BGLA_THEMA -
120 HHSearch 87.0641% -83 - C3 -4IPL 2.7 ?
93 PsiBlast_CBE 86.9137% -88 - C3 -3WH8 3.8 ?
79 PsiBlast_CBE 86.8239% -87 - C3 -2CBU 4.7 BGLA_THEMA
68 PsiBlast_CBE 86.7539% -85 - C3 -2J78 4.5 BGLA_THEMA
31 PsiBlast_CBE 86.7539% -83 - C3 -4PTV 4.4 ?
78 PsiBlast_CBE 86.4839% -85 - C3 -2CBU 5.0 BGLA_THEMA
66 PsiBlast_CBE 86.3439% -85 - C3 -2J79 4.2 BGLA_THEMA
72 PsiBlast_CBE 86.2939% -87 - C3 -2J75 4.3 BGLA_THEMA
69 PsiBlast_CBE 86.2639% -85 - C3 -2J78 4.6 BGLA_THEMA
95 PsiBlast_CBE 86.2337% -87 - C3 -3WH6 4.1 ?
63 PsiBlast_CBE 86.0239% -85 - C3 -2J7D 4.6 BGLA_THEMA
61 PsiBlast_CBE 86.0039% -88 - C3 -2J7G 4.4 BGLA_THEMA
94 PsiBlast_CBE 85.9937% -86 - C3 -3WH7 3.7 ?
60 PsiBlast_CBE 85.8439% -84 - C3 -2J7G 5.2 BGLA_THEMA
88 PsiBlast_CBE 85.7639% -85 - C3 -1OIF 3.7 BGLA_THEMA
70 PsiBlast_CBE 85.7639% -85 - C3 -2J77 4.4 BGLA_THEMA
80 PsiBlast_CBE 85.7339% -87 - C3 -1W3J 3.9 BGLA_THEMA
75 PsiBlast_CBE 85.5839% -84 - C3 -2CES 5.0 BGLA_THEMA
89 PsiBlast_CBE 85.4939% -84 - C3 -1OIF 3.9 BGLA_THEMA
67 PsiBlast_CBE 85.4639% -86 - C3 -2J79 4.1 BGLA_THEMA
83 PsiBlast_CBE 85.4039% -86 - C3 -1UZ1 3.9 BGLA_THEMA
84 PsiBlast_CBE 85.3639% -86 - C3 -1OIN 2.8 BGLA_THEMA
81 PsiBlast_CBE 85.3639% -84 * C3 *1W3J 4.0 BGLA_THEMA
77 PsiBlast_CBE 85.3439% -85 - C3 -2CBV 3.9 BGLA_THEMA
86 PsiBlast_CBE 85.3239% -85 - C3 -1OIM 4.2 BGLA_THEMA
62 PsiBlast_CBE 85.3039% -85 - C3 -2J7E 4.4 BGLA_THEMA
58 PsiBlast_CBE 85.2139% -85 - C3 -2JAL 3.7 BGLA_THEMA
96 PsiBlast_CBE 85.1837% -87 - C3 -3WH5 2.7 ?
56 PsiBlast_CBE 85.0739% -85 - C3 -2VRJ 4.8 BGLA_THEMA
41 PsiBlast_CBE 85.0537% -83 - C3 -4HZ8 4.2 ?
57 PsiBlast_CBE 85.0239% -90 - C3 -2VRJ 4.7 BGLA_THEMA
85 PsiBlast_CBE 84.9439% -84 - C3 -1OIN 3.2 BGLA_THEMA
74 PsiBlast_CBE 84.9139% -84 - C3 -2CES 4.7 BGLA_THEMA
65 PsiBlast_CBE 84.8939% -84 - C3 -2J7B 4.7 BGLA_THEMA
40 PsiBlast_CBE 84.8937% -81 - C3 -3CMJ 3.2 ?
82 PsiBlast_CBE 84.8739% -84 - C3 -1UZ1 4.0 BGLA_THEMA
87 PsiBlast_CBE 84.8039% -86 - C3 -1OIM 4.5 BGLA_THEMA
76 PsiBlast_CBE 84.7939% -83 - C3 -2CBV 4.3 BGLA_THEMA
59 PsiBlast_CBE 84.5339% -86 - C3 -2J7H 3.8 BGLA_THEMA
100 PsiBlast_CBE 84.3637% -79 - C3 -3WBE 2.7 BGL06_ORYSJ
42 PsiBlast_CBE 84.2937% -83 - C3 -4HZ7 4.0 ?
99 PsiBlast_CBE 83.8937% -80 - C3 -3GNO 2.0 BGL06_ORYSJ
71 PsiBlast_CBE 83.8539% -85 - C3 -2J75 4.8 BGLA_THEMA
97 PsiBlast_CBE 83.2137% -79 - C3 -3GNR 1.6 BGL06_ORYSJ
102 HHSearch 78.9034% -64 - C3 -2DGA 3.0 HGL1B_WHEAT
105 HHSearch 75.8232% -78 - C3 -1E4M 3.4 MYRA_SINAL