@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu12350: (2016-06-19 )
MIPLHENLAGKTAVITGGSGVLCSAMARELARHGMKVAILNRTAEKGQAVVKEITAAGGTACAVAADVLDRMSLERAKEDILGQFGAVDLLINGAGGNHPDAITDVETYEEAGEGQSFFDMDERGFLTVFSTNFTGAFLASQVFGKELLKADSPAIINLSSMSAYSPMTKVPAYSAAKASINNFTMWMAVHFAETGLRVNAIAPGFFLTKQNHDLLINQDGTFTSRSHKIIAGTPMKRFGKPEDLLGTLLWLADESYSGFVTGITVPVDGGFMAYSGV

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_A_3(4WUV)
?
[Raw transfer]




EDO_A_5(4WUV)
?
[Raw transfer]




1 PsiBlast_PDB 84.6147%-101 - C1 -4WUV 8.6 ?
42 PsiBlast_CBE 80.5033%-121 - C1 -4NBW - ? -
40 PsiBlast_CBE 76.9733%-118 - C1 -4NBW - ? -
18 PsiBlast_PDB 75.4033%-118 - C1 -4NBW - ? -
82 HHSearch 74.1828%-117 - C1 -3AWD - ? -
6 PsiBlast_PDB 73.3432%-102 - C1 -4G81 - ? -
69 HHSearch 73.3132%-106 - C1 -4J2H - ? -
41 PsiBlast_CBE 72.6533%-115 - C1 -4NBW - ? -
23 PsiBlast_CBE 72.6032%-103 - C1 -4G81 - ? -
22 PsiBlast_CBE 72.4432%-102 - C1 -4G81 - ? -
21 PsiBlast_CBE 71.6732% -99 - C1 -4G81 - ? -
7 PsiBlast_PDB 71.4131%-122 - C1 -4RZH - FABG1_SYNY3 -
66 HHSearch 70.6132% -95 - C1 -4G81 - ? -
20 PsiBlast_PDB 70.4230%-122 - C1 -3O03 - ? -
2 PsiBlast_PDB 68.9831%-107 - C1 -4J2H - ? -
16 PsiBlast_PDB 68.3432%-110 - C1 -3UF0 - ? -
15 PsiBlast_PDB 68.3430%-100 - C1 -1VL8 - ? -
11 PsiBlast_PDB 68.2531%-100 - C1 -4IBO - ? -
19 PsiBlast_PDB 67.4130%-123 - C1 -3CXR - ? -
28 PsiBlast_CBE 66.9931% -99 - C1 -4IBO - ? -