@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv0289: (2016-04-21 )
MDATPNAVELTVDNAWFIAETIGAGTFPWVLAITMPYSDAAQRGAFVDRQRDELTRMGLLSPQGVINPAVADWIKVVCFPDRWLDLRYVGPASADGACELLRGIVALRTGTGKTSNKTGNGVVALRNAQLVTFTAMDIDDPRALVPILGVGLAHRPPARFDEFSLPTRVGARADERLRSGVPLGEVVDYLGIPASARPVVESVFSGPRSYVEIVAGCNRDGRHTTTEVGLSIVDTSAGRVLVSPSRAFDGEWVSTFSPGTPFAIAVAIQTLTACLPDGQWFPGQRVSRDFSTQSS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CXS_A_2(5DLB)
?
[Raw transfer]




1 PsiBlast_PDB 98.72100%-148 - C6 -4W4I - ESPG3_MYCTU -
2 PsiBlast_PDB 93.0578%-160 - C6 -5DLB - ? -
11 HHSearch 90.4677%-163 - C6 -5DLB 3.2 ?
3 PsiBlast_PDB 85.1058%-144 - C6 -4RCL - ESPG3_MYCS2 -
12 HHSearch 72.6322%-115 - C6 -4W4L - ESPG5_MYCTU -
13 HHSearch 67.5461% -64 - C6 -4L4W - ESPG3_MYCS2 -
22 Fugue 67.3223%-101 - C6 -4KXR - ESPG5_MYCTU -
4 PsiBlast_PDB 66.4458% -62 - C6 -4L4W - ESPG3_MYCS2 -
5 PsiBlast_PDB 65.2559% -63 - C6 -4W4J - ESPG3_MYCS2 -
7 PsiBlast_PDB 60.0823% -83 - C6 -4W4L - ESPG5_MYCTU -
6 PsiBlast_PDB 58.1023% -86 - C6 -4KXR - ESPG5_MYCTU -
26 Fugue 42.1719% -61 - C6 -4X2Z - -
24 Fugue 40.9818% -55 - C1 -4M02 - -
30 Fugue 40.8517% -72 - C4 -4DAP - SFSA_ECOLI -
8 PsiBlast_PDB 36.1432% -6 - C6 -1G2I - PFPI_PYRHO -
27 Fugue 35.2320% -32 - C6 -4PX7 - ? -
29 Fugue 32.5213% -57 - C5 -3G8R - ? -
23 Fugue 32.2114% -32 - C6 -5AZB - LGT_ECOLI -
10 PsiBlast_PDB 28.1434% -25 - C3 -4W66 - ? -
17 HHSearch 26.0721% -37 - C6 -2I9X - SP5G_STAES -