@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv2470: (2016-05-11 )
MPKSFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDDLAGAEERLRMFLEQYWGGPRTYSEQRGHPRLRMRHAPFRISLIERDAWLRCMHTAVASIDSETLDDEHRRELLDYLEMAAHSLVNSPF

Atome Classification :

(28 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

HEM_A_2(2BMM)
?
[Raw transfer]



HEM_A_2(2BMM)
?
[Raw transfer]



HEM_A_2(1UX8)
TRHBO_BACSU
[Raw transfer]



HEM_A_2(4UZV)
?
[Raw transfer]



HEM_A_2(4UZV)
?
[Raw transfer]



OXY_A_3(2BKM)
?
[Raw transfer]



OXY_A_3(2BKM)
?
[Raw transfer]



OXY_B_5(2BKM)
?
[Raw transfer]
41 PsiBlast_CBE 99.4199%-145 - C5 -2QRW - TRHBO_MYCTU -
26 PsiBlast_CBE 98.18100%-140 - C5 -1NGK - TRHBO_MYCTU -
24 PsiBlast_CBE 97.70100%-139 - C5 -1NGK - TRHBO_MYCTU -
2 PsiBlast_PDB 97.2699%-141 - C5 -2QRW - TRHBO_MYCTU -
21 PsiBlast_CBE 97.07100%-137 - C5 -1NGK - TRHBO_MYCTU -
28 PsiBlast_CBE 96.92100%-141 - C5 -1NGK - TRHBO_MYCTU -
40 PsiBlast_CBE 96.9199%-140 - C5 -2QRW - TRHBO_MYCTU -
37 PsiBlast_CBE 96.8999%-139 - C5 -2QRW - TRHBO_MYCTU -
23 PsiBlast_CBE 96.84100%-138 - C5 -1NGK - TRHBO_MYCTU -
38 PsiBlast_CBE 96.7499%-140 - C5 -2QRW - TRHBO_MYCTU -
29 PsiBlast_CBE 96.68100%-143 - C5 -1NGK - TRHBO_MYCTU -
30 PsiBlast_CBE 96.64100%-143 - C5 -1NGK - TRHBO_MYCTU -
36 PsiBlast_CBE 96.6099%-140 - C5 -2QRW - TRHBO_MYCTU -
31 PsiBlast_CBE 96.56100%-140 - C5 -1NGK - TRHBO_MYCTU -
35 PsiBlast_CBE 96.4999%-137 - C5 -2QRW - TRHBO_MYCTU -
42 PsiBlast_CBE 96.4399%-140 - C5 -2QRW - TRHBO_MYCTU -
25 PsiBlast_CBE 96.04100%-135 - C5 -1NGK - TRHBO_MYCTU -
27 PsiBlast_CBE 95.98100%-139 - C5 -1NGK - TRHBO_MYCTU -
39 PsiBlast_CBE 95.8999%-140 - C5 -2QRW - TRHBO_MYCTU -
71 Fugue 95.88100%-140 - C5 -1NGK - TRHBO_MYCTU -
3 PsiBlast_PDB 72.7657%-119 - C5 -2BMM 11.0 ?
59 HHSearch 72.6759%-116 * C5 *2BMM 11.0 ?
65 HHSearch 70.6438%-114 - C5 -2BKM 3.1 ?
4 PsiBlast_PDB 70.3754%-123 - C5 -4UZV 10.6 ?
62 HHSearch 69.9655%-118 - C5 -4UZV 10.6 ?
5 PsiBlast_PDB 69.3938%-115 - C5 -2BKM 3.1 ?
43 PsiBlast_CBE 69.0738%-112 - C5 -2BKM 3.1 ?
6 PsiBlast_PDB 67.3139%-118 - C5 -1UX8 10.8 TRHBO_BACSU