@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv2970A: (2016-05-15 )
MLIRWHIQLGNIVIPKSVNPMRIASNFDAFDFPRSMTEPGLVRIRKPSISQAGEMT

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NDP_A_2(2BGS)
ALDR_HORVU
[Raw transfer]




NDP_A_4(3WBW)
?
[Raw transfer]




FLC_A_4(4GAC)
AK1A1_MOUSE
[Raw transfer]




4 PsiBlast_PDB 82.6662%-147 - C10 -4OTK - Y2971_MYCTU -
3 PsiBlast_PDB 81.9857% -95 - C10 -2WZT - Y2407_MYCS2 -
106 HHSearch 76.9943% -83 - C10 -4OTK - Y2971_MYCTU -
88 PsiBlast_CBE 75.7357% -95 - C10 -3Q65 - ALDR_HUMAN -
100 PsiBlast_CBE 75.3957%-112 * C10 *3GHU - ALDR_HUMAN -
47 PsiBlast_CBE 75.3757%-102 - C10 -2IPW - ALDR_HUMAN -
90 PsiBlast_CBE 75.3457%-111 - C10 -3ONC - ALDR_HUMAN -
82 PsiBlast_CBE 75.2857%-106 - C10 -4JIR - ALDR_HUMAN -
99 PsiBlast_CBE 75.2357%-111 - C10 -3LQG - ALDR_HUMAN -
30 PsiBlast_CBE 74.9448% -88 - C10 -4Q3M - ? -
32 PsiBlast_CBE 74.8548% -97 - C10 -4Q3M - ? -
91 PsiBlast_CBE 74.5257%-106 - C10 -3ONB - ALDR_HUMAN -
92 PsiBlast_CBE 74.3857%-106 - C10 -3MC5 - ALDR_HUMAN -
102 PsiBlast_CBE 74.3657%-109 - C10 -3GHS - ALDR_HUMAN -
31 PsiBlast_CBE 74.3648% -94 - C10 -4Q3M - ? -
5 PsiBlast_PDB 74.3055% -65 - C10 -1MZR - DKGA_ECOLI -
75 PsiBlast_CBE 74.1657%-105 - C10 -4NKC - ALDR_HUMAN -
68 PsiBlast_CBE 74.0857%-105 - C10 -4QBX - ALDR_HUMAN -
43 PsiBlast_CBE 73.9257%-102 - C10 -3LBO - ALDR_HUMAN -
24 PsiBlast_CBE 73.9257% -80 - C10 -2WZM - Y2407_MYCS2 -
122 HHSearch 69.2342% -56 - C10 -3WBW 5.4 ?
105 HHSearch 67.9735% -62 - C10 -4GAC 1.9 AK1A1_MOUSE
109 HHSearch 67.5931% -59 - C10 -2BGS 5.9 ALDR_HORVU