@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA1772: (2016-02-01 )
MHYVTPDLCDAYPELVQVVEPMFSNFGGRDSFGGEIVTIKCFEDNSLVKEQVDKDGKGKVLVVDGGGSLRRALLGDMLAEKAAKNGWEGIVVYGCIRDVDVIAQTDLGVQALASHPLKTDKRGIGDLNVAVTFGGVTFRPGEFVYADNNGIIVSPQALKMPE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_B_26(3C8O)
RRAAH_PSEAE
[Raw transfer]




PGE_B_(3C8O)
RRAAH_PSEAE
[Raw transfer]




PGE_B_(3C8O)
RRAAH_PSEAE
[Raw transfer]




18 PsiBlast_CBE 97.19100%-132 - C2 -3C8O 3.2 RRAAH_PSEAE
1 PsiBlast_PDB 97.06100%-133 - C2 -3C8O 3.3 RRAAH_PSEAE
23 HHSearch 94.8596%-130 - C2 -3C8O 3.3 RRAAH_PSEAE
19 PsiBlast_CBE 85.8655%-127 - C2 -2YJV - RRAA_ECOLI -
3 PsiBlast_PDB 85.8055%-128 - C2 -2YJT - RRAA_ECOLI -
4 PsiBlast_PDB 85.4655%-119 - C2 -2YJV - RRAA_ECOLI -
2 PsiBlast_PDB 84.7655%-121 - C2 -1Q5X - RRAA_ECOLI -
25 HHSearch 80.3349%-110 - C2 -1Q5X - RRAA_ECOLI -
22 HHSearch 79.8843%-118 - C2 -1J3L - RRAAH_THET8 -
7 PsiBlast_PDB 79.0043%-119 - C2 -1J3L - RRAAH_THET8 -
27 HHSearch 78.4344%-125 - C2 -1NXJ - RRAAH_MYCTU -
32 Fugue 78.3043%-124 * C2 *1NXJ - RRAAH_MYCTU -
20 PsiBlast_CBE 76.6544%-129 - C2 -1NXJ - RRAAH_MYCTU -
6 PsiBlast_PDB 76.2544%-128 - C2 -1NXJ - RRAAH_MYCTU -
8 PsiBlast_PDB 76.0145%-121 - C2 -2PCN - ? -
21 PsiBlast_CBE 75.6044%-125 - C2 -1NXJ - RRAAH_MYCTU -
26 HHSearch 65.8624%-103 - C2 -3NOJ - HMGA_PSEP1 -
28 HHSearch 65.6423%-120 - C2 -3K4I - ? -
34 Fugue 62.2027% -93 - C2 -3NOJ - HMGA_PSEP1 -
9 PsiBlast_PDB 60.3825%-155 - C2 -3K4I - ? -